From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005931000
  • symbol?: nasE
  • description?: assimilatory nitrite reductase

      descriptions from strain specific annotations:

    • assimilatory nitrite reductase
    • nitrite reductase (NAD(P)H) small subunit
    • nitrite reductase [NAD(P)H], small subunit
    • Nitrite reductase [NAD(P)H] small subunit
    • assimilatory nitrite reductase [NAD(P)H] small subunit
    • assimilatory nitrite reductase small subunit
    • assimilatory nitrite reductase [NAD(P)H], small subunit
    • Nitrite reductase small subunit
  • strand?: -
  • coordinates?: 5997127..5997441
  • synteny block?: BlockID0046750
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2397 (nirD)
    N315:
    SA2187 (nasE)
    NCTC8325:
    Newman:
    NWMN_2299 (nirD)
    USA300_FPR3757:
    04-02981:
    SA2981_2336 (nasE)
    08BA02176:
    C248_2446 (nasE)
    11819-97:
    MS7_2414 (nirD)
    71193:
    ST398NM01_2452
    ECT-R 2:
    ECTR2_2258 (nirD)
    ED133:
    SAOV_2445c
    ED98:
    SAAV_2464 (nirD)
    HO 5096 0412:
    SAEMRSA15_22980 (nasE)
    JH1:
    SaurJH1_2471
    JH9:
    SaurJH9_2423
    JKD6008:
    SAA6008_02440 (nirD)
    JKD6159:
    SAA6159_02300 (nirD)
    LGA251:
    SARLGA251_21810 (nasE)
    M013:
    M013TW_2360
    MRSA252:
    SAR2488 (nasE)
    MSHR1132:
    SAMSHR1132_22270
    MSSA476:
    SAS2290
    Mu3:
    SAHV_2383 (nasE)
    Mu50:
    SAV2399 (nasE)
    MW2:
    MW2321 (nasE)
    RF122:
    SAB2279c (nasE)
    ST398:
    SAPIG2452 (nirD)
    T0131:
    SAT0131_02590 (pyrAA)
    TCH60:
    HMPREF0772_10788 (nirD)
    TW20:
    SATW20_25290 (nasE)
    USA300_TCH1516:
    USA300HOU_2381 (nirD)
    VC40:
    SAVC_10865

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             METKEKIKVTTIDELTPLIGKKVIVKGKEVGLFLTESGKIHAIHNICPHKQGPLSEGTVS
    N315            METKEKIKVTTIDELTPLIGKKVIVKGKEVGLFLTESGTIHAIHNICPHKQGPLSEGTVS
    NCTC8325        METKEKIKVTTIDELTPLIGKKVIVKGKEVGLFLTESGKIHAIHNICPHKQGPLSEGTVS
    Newman          METKEKIKVTTIDELTPLIGKKVIVKGKEVGLFLTESGKIHAIHNICPHKQGPLSEGTVS
    USA300_FPR3757  METKEKIKVTTIDELTPLIGKKVIVKGKEVGLFLTESGKIHAIHNICPHKQGPLSEGTVS
                    **************************************.*********************

    COL             GEYVFCPLHDQKIDLNTGIVQEPDEGCVDVYEVEVTDGNVYICL
    N315            GEYVFCPLHDQKIDLNTGIVQEPDEGCVDVYEVEVTDGNVYICL
    NCTC8325        GEYVFCPLHDQKIDLNTGIVQEPDEGCVDVYEVEVTDGNVYICL
    Newman          GEYVFCPLHDQKIDLNTGIVQEPDEGCVDVYEVEVTDGNVYICL
    USA300_FPR3757  GEYVFCPLHDQKIDLNTGIVQEPDEGCVDVYEVEVTDGNVYICL
                    ********************************************