From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2306 [new locus tag: NWMN_RS13255 ]
  • pan locus tag?: SAUPAN005938000
  • symbol: NWMN_2306
  • pan gene symbol?:
  • synonym:
  • product: Zn-binding lipoprotein adcA-like protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2306 [new locus tag: NWMN_RS13255 ]
  • symbol: NWMN_2306
  • product: Zn-binding lipoprotein adcA-like protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2533123..2534718
  • length: 1596
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    1261
    1321
    1381
    1441
    1501
    1561
    ATGAAAAAGAAATTAGGTATGTTACTTCTTGTACCAGCCGTAACTTTATCATTAGCCGCA
    TGTGGGAATGATGATGGAAAAGATAAAGATGGCAAGGTAACAATTAAAACGACAGTTTAT
    CCATTGCAATCATTTGCAGAGCAAATTGGTGGAAAACACGTGAAGGTATCATCAATCTAT
    CCAGCAGGGACAGATTTACATAGCTATGAACCAACACAAAAAGATATATTAAGTGCAAGC
    AAGTCAGACTTGTTTATGTATACAGGGGATAATTTAGATCCGGTTGCTAAGAAAGTTGCA
    TCTACTATCAAAGATAAAGATAAAAAACTGTCTTTAGAGGATAAATTAGATAAAGCAAAG
    CTTTTAACTGATCAACACGAGCATGGTGAAGAGCATGAACATGAGGGACATGATCATGAG
    AAAGAAGAACATCATCATCATCATGGTGGATATGATCCACACGTATGGTTAGATCCTAAA
    ATTAACCAAACTTTCGCTAAAGAAATTAAAGATGAATTAGTGAAAAAAGATCCAAAACAT
    AAAGATGACTATGAGAAAAACTACAAAAAATTAAACGACGATCTTAAGAAAATTGATAAC
    GATATGAAGCAAGTTACAAAAGATAAGCAAGGTAATGCAGTATTCATTTCACATGAATCA
    ATTGGATACTTAGCTGATTGTTATGGTTTTGTTCAAAAAGGTATTCAAAACATGAATGCT
    GAAGATCCATCACAAAAAGAATTAACTAAAATTGTTAAAGAAATTAGAGATAGCAATGCT
    AAATATATTCTTTACGAAGATAATGTTGCGAATAAAGTGACTGAAACAATTCGTAAAGAA
    ACAGATGCGAAGCCTTTAAAATTCTACAACATGGAGTCTTTAAATAAAGAACAACAGAAA
    AAAGATAATATTACGTATCAATCATTAATGAAATCTAATATTGAAAATATCGGTAAAGCT
    TTAGACAGTGGTGTTAAAGTGAAAGACGACAAAGCTGAAAGTAAACATGACAAAGCAATT
    TCTGATGGGTATTTTAAAGATGAGCAAGTTAAAGACCGTGAATTAAGCGATTATGCTGGT
    GAATGGCAATCTGTTTACCCTTACTTAAAAGACGGTACGCTTGATGAAGTGATGGAACAT
    AAAGCTGAAAATGATCCGAAGAAATCTGCTAAAGATTTAAAAGCTTATTATGACAAAGGA
    TATAAAACTGATATTACTAACATTGATATAAAAGGAAATGAAATTACATTTACTAAAGAT
    GGTAAGAAACACACTGGTAAATATGAATACAATGGTAAGAAAACATTGAAATATCCTAAA
    GGTAACCGTGGCGTGAGATTTATGTTTAAATTGGTCGATGGTAATGATAAAGACTTACCG
    AAATTCATCCAATTTAGCGATCACCACATTGCACCTAAAAAGGCAGAACACTTCCATATC
    TTTATGGGTAATGATAATGACGCGTTATTAAAAAGAATGGATTACTGGCCAACATATTAT
    CCTTCAAAATTAAATAAAGACCCAATCAAAGAAGAAATGTTAGCGCATTATTTCAACAGG
    TTTGCACACTCTACTCAACTGTTAATAGCTGAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1260
    1320
    1380
    1440
    1500
    1560
    1596

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2306 [new locus tag: NWMN_RS13255 ]
  • symbol: NWMN_2306
  • description: Zn-binding lipoprotein adcA-like protein
  • length: 531
  • theoretical pI: 7.33174
  • theoretical MW: 61046.4
  • GRAVY: -1.00226

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsUnknown substrateanchored repeat ABC transporter, substrate-binding protein (TIGR03772; HMM-score: 87)
  • TheSEED:  
    Candidate zinc-binding lipoprotein ZinT 
  • PFAM:
    Calycin (CL0116) ZinT; ZinT (YodA) periplasmic lipocalin-like zinc-recruitment (PF09223; HMM-score: 261.3)
    Chelatase (CL0043) ZnuA; Zinc-uptake complex component A periplasmic (PF01297; HMM-score: 221.5)
    no clan definedDUF4845; Domain of unknown function (DUF4845) (PF16137; HMM-score: 17.1)
    DUF4971; Domain of unknown function (DUF4971) (PF16341; HMM-score: 15.3)
    DUF3107; Protein of unknown function (DUF3107) (PF11305; HMM-score: 13.6)
    DUF4407; Domain of unknown function (DUF4407) (PF14362; HMM-score: 6.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 9.68
    • Cellwall Score: 0.17
    • Extracellular Score: 0.16
    • Internal Helices: 0
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular Possibility: 0
    • Signal Peptide Possibility: 0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: LSLAACG
  • SignalP: Signal peptide length 20 aa
    • Ymax: 0.334
    • Ymax_pos: 20
    • Cmax: 0.145
    • Cmax_pos: 28
    • Smax: 0.952
    • Smax_pos: 6
    • Smean: 0.891
    • D: 0.551
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKKKLGMLLLVPAVTLSLAACGNDDGKDKDGKVTIKTTVYPLQSFAEQIGGKHVKVSSIYPAGTDLHSYEPTQKDILSASKSDLFMYTGDNLDPVAKKVASTIKDKDKKLSLEDKLDKAKLLTDQHEHGEEHEHEGHDHEKEEHHHHHGGYDPHVWLDPKINQTFAKEIKDELVKKDPKHKDDYEKNYKKLNDDLKKIDNDMKQVTKDKQGNAVFISHESIGYLADCYGFVQKGIQNMNAEDPSQKELTKIVKEIRDSNAKYILYEDNVANKVTETIRKETDAKPLKFYNMESLNKEQQKKDNITYQSLMKSNIENIGKALDSGVKVKDDKAESKHDKAISDGYFKDEQVKDRELSDYAGEWQSVYPYLKDGTLDEVMEHKAENDPKKSAKDLKAYYDKGYKTDITNIDIKGNEITFTKDGKKHTGKYEYNGKKTLKYPKGNRGVRFMFKLVDGNDKDLPKFIQFSDHHIAPKKAEHFHIFMGNDNDALLKRMDYWPTYYPSKLNKDPIKEEMLAHYFNRFAHSTQLLIAE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: NWMN_1457 (Zur*)
    Zur* (TF) important in Zinc homeostasis  RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]