From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005938000
  • symbol?:
  • description?: zinc ABC transporter substrate-binding protein

      descriptions from strain specific annotations:

    • zinc ABC transporter substrate-binding protein
    • Zn-binding lipoprotein adcA-like protein
    • ABC transporter substrate-binding protein
    • ABC superfamily ATP binding cassette transporter, binding protein
    • ABC transporter ATP-binding protein
    • Candidate zinc-binding lipoprotein ZinT
    • High-affinity zinc uptake system protein znuA
    • periplasmic solute binding family protein
    • putative solute binding lipoprotein
    • putative zinc-binding lipo protein ZinT
    • ribulose-phosphate 3-epimerase
    • zinc-binding lipoprotein AdcA
    • Zn-binding lipoprotein adcA
  • strand?: -
  • coordinates?: 6004037..6005632
  • synteny block?: BlockID0046820
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2343 (zinT)
    08BA02176:
    C248_2453
    11819-97:
    MS7_2421
    71193:
    ST398NM01_2459
    ECT-R 2:
    ECTR2_2265
    ED133:
    SAOV_2452c
    ED98:
    SAAV_2471
    HO 5096 0412:
    SAEMRSA15_23050
    JH1:
    SaurJH1_2478
    JH9:
    SaurJH9_2430
    JKD6008:
    SAA6008_02447
    JKD6159:
    SAA6159_02307
    LGA251:
    SARLGA251_21880
    M013:
    M013TW_2367
    MRSA252:
    SAR2496
    MSHR1132:
    SAMSHR1132_22340
    MSSA476:
    SAS2297
    Mu3:
    SAHV_2390
    Mu50:
    SAV2406
    MW2:
    MW2328
    RF122:
    SAB2286c
    ST398:
    SAPIG2459
    T0131:
    SAT0131_02597
    TCH60:
    HMPREF0772_10781 (adcA)
    TW20:
    SATW20_25360
    USA300_TCH1516:
    USA300HOU_2386
    VC40:
    SAVC_10900

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKKLGMLLLVPAVTLSLAACGNDDGKDKDGKVTIKTTVYPLQSFAEQIGGKHVKVSSIY
    N315            MKKKLGMLLLVPAVTLSLAACGNDDGKDKDGKVTIKTTVYPLQSFAEQIGGKHVKVSSIY
    NCTC8325        MKKKLGMLLLVPAVTLSLAACGNDDGKDKDGKVTIKTTVYPLQSFAEQIGGKHVKVSSIY
    Newman          MKKKLGMLLLVPAVTLSLAACGNDDGKDKDGKVTIKTTVYPLQSFAEQIGGKHVKVSSIY
    USA300_FPR3757  MKKKLGMLLLVPAVTLSLAACGNDDGKDKDGKVTIKTTVYPLQSFAEQIGGKHVKVSSIY
                    ************************************************************

    COL             PAGTDLHSYEPTQKDILSASKSDLFMYTGDNLDPVAKKVASTIKDKDKKLSLEDKLDKAK
    N315            PAGTDLHSYEPTQKDILSASKSDLFMYTGDNLDPVAKKVASTIKDKDKKRSLEDKLDKAK
    NCTC8325        PAGTDLHSYEPTQKDILSASKSDLFMYTGDNLDPVAKKVASTIKDKDKKLSLEDKLDKAK
    Newman          PAGTDLHSYEPTQKDILSASKSDLFMYTGDNLDPVAKKVASTIKDKDKKLSLEDKLDKAK
    USA300_FPR3757  PAGTDLHSYEPTQKDILSASKSDLFMYTGDNLDPVAKKVASTIKDKDKKLSLEDKLDKAK
                    ************************************************* **********

    COL             LLTDQHEHGEEHEHEGHDHEKEEHHHHHGGYDPHVWLDPKINQTFAKEIKDELVKKDPKH
    N315            LLTDQHEHGEEHEHEGHDHEKEE-HHHHGGYDPHVWLDPKINQTFAKEIKDELVKKDPKH
    NCTC8325        LLTDQHEHGEEHEHEGHDHEKEEHHHHHGGYDPHVWLDPKINQTFAKEIKDELVKKDPKH
    Newman          LLTDQHEHGEEHEHEGHDHEKEEHHHHHGGYDPHVWLDPKINQTFAKEIKDELVKKDPKH
    USA300_FPR3757  LLTDQHEHGEEHEHEGHDHEKEEHHHHHGGYDPHVWLDPKINQTFAKEIKDELVKKDPKH
                    *********************** ************************************

    COL             KDDYEKNYKKLNDDLKKIDNDMKQVTKDKQGNAVFISHESIGYLADCYGFVQKGIQNMNA
    N315            KDDYEKNYKKLNDDLKKIDNDMKQVTKDKQGNAVFISHESIGYLADRYGFVQKGIQNMNA
    NCTC8325        KDDYEKNYKKLNDDLKKIDNDMKQVTKDKQGNAVFISHESIGYLADCYGFVQKGIQNMNA
    Newman          KDDYEKNYKKLNDDLKKIDNDMKQVTKDKQGNAVFISHESIGYLADCYGFVQKGIQNMNA
    USA300_FPR3757  KDDYEKNYKKLNDDLKKIDNDMKQVTKDKQGNAVFISHESIGYLADCYGFVQKGIQNMNA
                    ********************************************** *************

    COL             EDPSQKELTKIVKEIRDSNAKYILYEDNVANKVTETIRKETDAKPLKFYNMESLNKEQQK
    N315            EDPSQKELTKIVKEIRDSNAKYILYEDNVANKVTETIRKETDAKPLKFYNMESLNKEQQK
    NCTC8325        EDPSQKELTKIVKEIRDSNAKYILYEDNVANKVTETIRKETDAKPLKFYNMESLNKEQQK
    Newman          EDPSQKELTKIVKEIRDSNAKYILYEDNVANKVTETIRKETDAKPLKFYNMESLNKEQQK
    USA300_FPR3757  EDPSQKELTKIVKEIRDSNAKYILYEDNVANKVTETIRKETDAKPLKFYNMESLNKEQQK
                    ************************************************************

    COL             KDNITYQSLMKSNIENIGKALDSGVKVKDDKAESKHDKAISDGYFKDEQVKDRELSDYAG
    N315            KDNITYQSLMKSNIENIGKALDSGVKVKDDKAESKHDKAISDGYFKDEQVKDRELSDYAG
    NCTC8325        KDNITYQSLMKSNIENIGKALDSGVKVKDDKAESKHDKAISDGYFKDEQVKDRELSDYAG
    Newman          KDNITYQSLMKSNIENIGKALDSGVKVKDDKAESKHDKAISDGYFKDEQVKDRELSDYAG
    USA300_FPR3757  KDNITYQSLMKSNIENIGKALDSGVKVKDDKAESKHDKAISDGYFKDEQVKDRELSDYAG
                    ************************************************************

    COL             EWQSVYPYLKDGTLDEVMEHKAENDPKKSAKDLKAYYDKGYKTDITNIDIKGNEITFTKD
    N315            EWQSVYPYLKDGTLDEVMEHKAENDPKKSAKDLKAYYDKGYKTDITNIDIKGNEITFTKD
    NCTC8325        EWQSVYPYLKDGTLDEVMEHKAENDPKKSAKDLKAYYDKGYKTDITNIDIKGNEITFTKD
    Newman          EWQSVYPYLKDGTLDEVMEHKAENDPKKSAKDLKAYYDKGYKTDITNIDIKGNEITFTKD
    USA300_FPR3757  EWQSVYPYLKDGTLDEVMEHKAENDPKKSAKDLKAYYDKGYKTDITNIDIKGNEITFTKD
                    ************************************************************

    COL             GKKHTGKYEYNGKKTLKYPKGNRGVRFMFKLVDGNDKDLPKFIQFSDHNIAPKKAEHFHI
    N315            GKKHTGKYEYNGKKTLKYPKGNRGVRFMFKLVDGNDKDLPKFIQFSDHNIAPKKAEHFHI
    NCTC8325        GKKHTGKYEYNGKKTLKYPKGNRGVRFMFKLVDGNDKDLPKFIQFSDHNIAPKKAEHFHI
    Newman          GKKHTGKYEYNGKKTLKYPKGNRGVRFMFKLVDGNDKDLPKFIQFSDHHIAPKKAEHFHI
    USA300_FPR3757  GKKHTGKYEYNGKKTLKYPKGNRGVRFMFKLVDGNDKDLPKFIQFSDHNIAPKKAEHFHI
                    ************************************************:***********

    COL             FMGNDNDALLKEMDNWPTYYPSKLNKDQIKEEMLAH---------------
    N315            FMGNDNDALLKEMDNWPTYYPSKLNKDQIKEEMLAH---------------
    NCTC8325        FMGNDNDALLKEMDNWPTYYPSKLNKDQIKEEMLAH---------------
    Newman          FMGNDNDALLKRMDYWPTYYPSKLNKDPIKEEMLAHYFNRFAHSTQLLIAE
    USA300_FPR3757  FMGNDNDALLKEMDNWPTYYPSKLNKDQIKEEMLAH---------------
                    ***********.** ************ ********