From AureoWiki
Jump to: navigation, search

NCBI: 06-JUL-2013

⊟Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2360 [new locus tag: NWMN_RS13605 ]
  • pan locus tag?: SAUPAN006023000
  • symbol: opp1F
  • pan gene symbol?: cntF
  • synonym:
  • product: peptide ABC transporter ATP-binding protein

⊟Genome View[edit source | edit]

⊟Gene[edit source | edit]

⊟General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2360 [new locus tag: NWMN_RS13605 ]
  • symbol: opp1F
  • product: peptide ABC transporter ATP-binding protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2597320..2598069
  • length: 750
  • essential: unknown other strains

⊟Accession numbers[edit source | edit]

⊟Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGATTAAAATTAAAGATGTTGAAAAGTCATATCAAAGCGCACATGTTTTTAAGCGTCGT
    CGAACACCTATCGTGAAAGGTGTGTCATTTGAGTGTCCAATCGGTGCGACGATTGCGATT
    ATCGGAGAAAGTGGTAGCGGTAAATCGACGTTGAGTCGTATGATATTAGGTATTGAGAAA
    CCGGATAAAGGTTGTGTAACCTTAAATGATCAACCGATGCATAAGAAGAAAGTGAGACGT
    CATCAAATTGGTGCTGTATTTCAAGATTATACGTCATCATTACATCCATTTCAGACTGTT
    AGAGAAATCTTATTTGAAGTGATGTGTCAATGTGATGGACAACCTAAAGAAGTTATGGAA
    GTCCAAGCAATTACATTGTTGGAAGAAGTCGGTCTATCTAAGGCATACATGGATAAATAT
    CCTAATATGTTATCAGGTGGAGAGGCGCAACGTGTTGCGATTGCGCGTGCAATATGTATT
    AACCCTAAATATATTTTGTTTGATGAAGCCATTAGTTCACTCGACATGTCAATTCAAACA
    CAAATATTAGATTTATTGATTCATTTACGTGAAACGCGTCAGTTGAGTTATATTTTTATC
    ACACATGATATTCAAGCTGCCACGTATTTATGTGATCAATTAATTATTTTTAAAAACGGA
    AAAATAGAAGAACAAATTCCGACAAGCGCATTGCATAAAAGTGACAATGCTTATACAAGA
    GAATTAATAGAAAAACAACTATCATTCTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    750

⊟Protein[edit source | edit]

⊟General[edit source | edit]

  • locus tag: NWMN_2360 [new locus tag: NWMN_RS13605 ]
  • symbol: Opp1F
  • description: peptide ABC transporter ATP-binding protein
  • length: 249
  • theoretical pI: 8.12738
  • theoretical MW: 28179.6
  • GRAVY: -0.145382

⊟Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsCations and iron carrying compoundsnickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 215)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsnickel import ATP-binding protein NikD (TIGR02770; HMM-score: 156.2)
    MetabolismTransport and binding proteinsAnionssulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 153.7)
    MetabolismTransport and binding proteinsUnknown substrateenergy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 150.7)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesglycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 144.3)
    MetabolismTransport and binding proteinsUnknown substrateenergy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 142.5)
    MetabolismTransport and binding proteinsAnionsmolybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 138)
    Genetic information processingProtein fateProtein and peptide secretion and traffickinglipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 135.2)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesputative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 135.1)
    ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 134.8)
    MetabolismTransport and binding proteinsAnionsphosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 133.1)
    D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 128)
    Cellular processesCellular processesToxin production and resistanceputative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 127.2)
    MetabolismTransport and binding proteinsUnknown substrateputative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 127.2)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminespolyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 125.7)
    MetabolismTransport and binding proteinsAnionsnitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 120.5)
    MetabolismTransport and binding proteinsOthernitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 120.5)
    2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 119.6)
    Cellular processesCellular processesCell divisioncell division ATP-binding protein FtsE (TIGR02673; HMM-score: 119.5)
    Cellular processesCellular processesBiosynthesis of natural productsNHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 115.7)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesNHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 115.7)
    MetabolismTransport and binding proteinsAnionsphosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 115.3)
    MetabolismTransport and binding proteinsOtherthiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 107.8)
    proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 107.4)
    ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 105.5)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminescholine ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 105.4)
    thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 102.4)
    MetabolismEnergy metabolismMethanogenesismethyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 102.3)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesLPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 102.2)
    MetabolismTransport and binding proteinsOtherLPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 102.2)
    MetabolismTransport and binding proteinsCations and iron carrying compoundscobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 99.2)
    Cellular processesCellular processesPathogenesistype I secretion system ATPase (TIGR03375; HMM-score: 98.2)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype I secretion system ATPase (TIGR03375; HMM-score: 98.2)
    Cellular processesCellular processesBiosynthesis of natural productsNHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 96.7)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesNHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 96.7)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesurea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 96.3)
    MetabolismTransport and binding proteinsOtherdaunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 96.2)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype I secretion system ATPase (TIGR01846; HMM-score: 95.6)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 93.8)
    thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 92.9)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype I secretion system ATPase (TIGR01842; HMM-score: 91)
    MetabolismTransport and binding proteinsOtherantigen peptide transporter 2 (TIGR00958; HMM-score: 90)
    phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 87.4)
    ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 86)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharideslipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 85.9)
    MetabolismTransport and binding proteinsOtherlipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 85.9)
    Cellular processesCellular processesOthernodulation ABC transporter NodI (TIGR01288; HMM-score: 82.5)
    MetabolismTransport and binding proteinsOthernodulation ABC transporter NodI (TIGR01288; HMM-score: 82.5)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingABC-type bacteriocin transporter (TIGR01193; HMM-score: 79.8)
    Genetic information processingProtein fateProtein modification and repairABC-type bacteriocin transporter (TIGR01193; HMM-score: 79.8)
    MetabolismTransport and binding proteinsOtherABC-type bacteriocin transporter (TIGR01193; HMM-score: 79.8)
    MetabolismTransport and binding proteinsUnknown substrateanchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 79.7)
    gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 75)
    MetabolismCentral intermediary metabolismPhosphorus compoundsphosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 72.8)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsglucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 72.2)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingheme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 71.6)
    MetabolismTransport and binding proteinsOtherheme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 71.6)
    MetabolismTransport and binding proteinsOtherpigment precursor permease (TIGR00955; HMM-score: 70.4)
    lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 67)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtherFeS assembly ATPase SufC (TIGR01978; HMM-score: 63.4)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesurea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 60.9)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsD-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 58.3)
    ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 56.9)
    MetabolismTransport and binding proteinsOthermulti drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 50.3)
    MetabolismTransport and binding proteinsOtherrim ABC transporter (TIGR01257; HMM-score: 48)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsperoxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 42.7)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminescyclic peptide transporter (TIGR01194; HMM-score: 40.5)
    MetabolismTransport and binding proteinsOthercyclic peptide transporter (TIGR01194; HMM-score: 40.5)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairexcinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 36.9)
    MetabolismTransport and binding proteinsAnionscystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 32)
    MetabolismTransport and binding proteinsOtherpleiotropic drug resistance family protein (TIGR00956; HMM-score: 24.3)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotidesuridine kinase (TIGR00235; EC 2.7.1.48; HMM-score: 12.4)
  • TheSEED:  
    Oligopeptide transporter putative ATPase domain 
  • PFAM:
    P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 107.3)
    SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 21.9)
    AAA_22; AAA domain (PF13401; HMM-score: 19.2)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 18.1)
    AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 17)
    AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 16)
    Sigma54_activat; Sigma-54 interaction domain (PF00158; HMM-score: 15.7)
    MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 14.3)
    AAA_24; AAA domain (PF13479; HMM-score: 14.2)
    NACHT; NACHT domain (PF05729; HMM-score: 14.1)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 13.9)
    AAA_33; AAA domain (PF13671; HMM-score: 13.8)
    DLIC; Dynein light intermediate chain (DLIC) (PF05783; HMM-score: 13.1)
    SbcCD_C; Putative exonuclease SbcCD, C subunit (PF13558; HMM-score: 12.8)
    AAA_13; AAA domain (PF13166; HMM-score: 12.3)
    DUF87; Domain of unknown function DUF87 (PF01935; HMM-score: 12)
    NB-ARC; NB-ARC domain (PF00931; HMM-score: 11.1)
    AAA_23; AAA domain (PF13476; HMM-score: 10.7)

⊟Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    NWMN_0510(tufA)elongation factor Tu  [1] (data from MRSA252)

⊟Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.05
    • Cytoplasmic Membrane Score: 8.78
    • Cellwall Score: 0.08
    • Extracellular Score: 0.09
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.163
    • Ymax_pos: 39
    • Cmax: 0.117
    • Cmax_pos: 42
    • Smax: 0.286
    • Smax_pos: 35
    • Smean: 0.2
    • D: 0.177
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit source | edit]

⊟Protein sequence[edit source | edit]

  • MIKIKDVEKSYQSAHVFKRRRTPIVKGVSFECPIGATIAIIGESGSGKSTLSRMILGIEKPDKGCVTLNDQPMHKKKVRRHQIGAVFQDYTSSLHPFQTVREILFEVMCQCDGQPKEVMEVQAITLLEEVGLSKAYMDKYPNMLSGGEAQRVAIARAICINPKYILFDEAISSLDMSIQTQILDLLIHLRETRQLSYIFITHDIQAATYLCDQLIIFKNGKIEEQIPTSALHKSDNAYTRELIEKQLSF

⊟Experimental data[edit source | edit]

  • experimentally validated: no data available

⊟Expression & Regulation[edit source | edit]

⊟Operon[edit source | edit]

⊟Regulation[edit source | edit]

  • sigma factor:
  • regulator:

⊟Transcription pattern[edit source | edit]

⊟Protein synthesis (provided by Aureolib)[edit source | edit]

⊟Protein stability[edit source | edit]

  • half-life: no data available

⊟Biological Material[edit source | edit]

⊟Mutants[edit source | edit]

⊟Expression vector[edit source | edit]

⊟lacZ fusion[edit source | edit]

⊟GFP fusion[edit source | edit]

⊟two-hybrid system[edit source | edit]

⊟FLAG-tag construct[edit source | edit]

⊟Antibody[edit source | edit]

⊟Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

⊟Literature[edit source | edit]

⊟References[edit source | edit]

  1. ↑ Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit source | edit]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=NWMN_2360&oldid=71559"