From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006023000
  • symbol?: cntF
  • description?: oligopeptide transporter ATPase

      descriptions from strain specific annotations:

    • oligopeptide transporter ATPase
    • oligopeptide transporter ATPase subunit
    • ABC transporter
    • peptide ABC transporter ATP-binding protein
    • Oligopeptide transporter putative ATPase domain protein
    • ABC transporter family protein
    • oligopeptide ABC transporter ATP-binding protein
    • oligopeptide ABC transporter ATP-binding protein Opp-1F
    • oligopeptide transporter putative ATPase domain
    • ABC superfamily ATP binding cassette transporter, ABC protein
    • peptide ABC transporter, ATP-binding protein
    • nickel transport ATP-binding protein
    • oligopeptide transporter ATPase domain-containing protein
  • strand?: -
  • coordinates?: 6079834..6080583
  • synteny block?: BlockID0047670
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA2251 (opp-1F)
    NCTC8325:
    Newman:
    NWMN_2360 (opp1F)
    USA300_FPR3757:
    04-02981:
    SA2981_2400 (opp-1F)
    08BA02176:
    C248_2513 (opp-1F)
    11819-97:
    MS7_2476
    71193:
    ST398NM01_2513
    ECT-R 2:
    ECTR2_2320
    ED133:
    SAOV_2513c
    ED98:
    SAAV_2529
    HO 5096 0412:
    SAEMRSA15_23610 (opp-1F)
    JH1:
    SaurJH1_2539
    JH9:
    SaurJH9_2490
    JKD6008:
    SAA6008_02504 (opp-1F)
    JKD6159:
    SAA6159_02360 (opp-1F)
    LGA251:
    SARLGA251_22430 (opp-1F)
    M013:
    M013TW_2423
    MRSA252:
    SAR2550 (opp-1F)
    MSHR1132:
    SAMSHR1132_22880
    MSSA476:
    SAS2354
    Mu3:
    SAHV_2447
    Mu50:
    SAV2463
    MW2:
    MW2387 (opp-1F)
    RF122:
    SAB2346c (opp1F)
    ST398:
    SAPIG2513
    T0131:
    SAT0131_02662 (lytN)
    TCH60:
    HMPREF0772_10726 (opp-1F)
    TW20:
    SATW20_25910 (opp-1F)
    USA300_TCH1516:
    USA300HOU_2454
    VC40:
    SAVC_11185

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIKIKDVEKSYQSAHVFKRRRTPIVKGVSFECPIGATIAIIGESGSGKSTLSRMILGIEK
    N315            MIKVTDVEKSYQSAHVFKRRRTPIVKGVSFECPIGATIAIIGESGSGKSTLSRMILGIEK
    NCTC8325        MIKIKDVEKSYQSAHVFKRRRTPIVKGVSFECPIGATIAIIGESGSGKSTLSRMILGIEK
    Newman          MIKIKDVEKSYQSAHVFKRRRTPIVKGVSFECPIGATIAIIGESGSGKSTLSRMILGIEK
    USA300_FPR3757  MIKIKDVEKSYQSAHVFKRRRTPIVKGVSFECPIGATIAIIGESGSGKSTLSRMILGIEK
                    ***:.*******************************************************

    COL             PDKGCVTLNDQPMHKKKVRRHQIGAVFQDYTSSLHPFQTVREILFEVMCQCDGQPKEVME
    N315            PDKGCVTLNDLPMHKKKVRRHQIGAVFQDYTSSLHPFQTVREILFEVMCQCDGQPKEVME
    NCTC8325        PDKGCVTLNDQPMHKKKVRRHQIGAVFQDYTSSLHPFQTVREILFEVMCQCDGQPKEVME
    Newman          PDKGCVTLNDQPMHKKKVRRHQIGAVFQDYTSSLHPFQTVREILFEVMCQCDGQPKEVME
    USA300_FPR3757  PDKGCVTLNDQPMHKKKVRRHQIGAVFQDYTSSLHPFQTVREILFEVMCQCDGQPKEVME
                    ********** *************************************************

    COL             VQAITLLEEVGLSKAYMDKYPNMLSGGEAQRVAIARAICINPKYILFDEAISSLDMSIQT
    N315            VQAITLLEEVGLSKAYMDKYPNMLSGGEAQRVAIARAICINPKYILFDEAISSLDMSIQT
    NCTC8325        VQAITLLEEVGLSKAYMDKYPNMLSGGEAQRVAIARAICINPKYILFDEAISSLDMSIQT
    Newman          VQAITLLEEVGLSKAYMDKYPNMLSGGEAQRVAIARAICINPKYILFDEAISSLDMSIQT
    USA300_FPR3757  VQAITLLEEVGLSKAYMDKYPNMLSGGEAQRVAIARAICINPKYILFDEAISSLDMSIQT
                    ************************************************************

    COL             QILDLLIHLRETRQLSYIFITHDIQAATYLCDQLIIFKNGKIEEQIPTSALHKSDNAYTR
    N315            QILDLLIHLRETRQLSYIFITHDIQAATYLCDQLIIFKNGKIEEQIPTSALHKSDNAYTR
    NCTC8325        QILDLLIHLRETRQLSYIFITHDIQAATYLCDQLIIFKNGKIEEQIPTSALHKSDNAYTR
    Newman          QILDLLIHLRETRQLSYIFITHDIQAATYLCDQLIIFKNGKIEEQIPTSALHKSDNAYTR
    USA300_FPR3757  QILDLLIHLRETRQLSYIFITHDIQAATYLCDQLIIFKNGKIEEQIPTSALHKSDNAYTR
                    ************************************************************

    COL             ELIEKQLSF
    N315            ELIEKQLSF
    NCTC8325        ELIEKQLSF
    Newman          ELIEKQLSF
    USA300_FPR3757  ELIEKQLSF
                    *********