From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2372 [new locus tag: NWMN_RS13665 ]
  • pan locus tag?: SAUPAN006040000
  • symbol: NWMN_2372
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2372 [new locus tag: NWMN_RS13665 ]
  • symbol: NWMN_2372
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2610443..2610862
  • length: 420
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGTCCAAAAAACATGTTTTTATAATTATTGGTGTCATATTGTGTATATGTACAGTTTCT
    ACGGTCATGCATTTTAAAATGAAATATGATGAAAAAGAAAAACAAAAAGCGATTTACTAC
    AAAGAACAACAAGAACGTATTACACTCTATCTTAAGCATAATACTAAAGAAACGAACACG
    ATTAAATCTGTACATTTCACAAACTTGGAAACAAGTCCTATGGGAAGTGCTGTGATTGAA
    GGATACATCAATGAAAATAAAGAAGATGATTTTACTGCTTATGCATCGCCTGAACATAAT
    TATCAATTTGGTGGCGCTATGATAAAAAGTGAAGGAGTAGATAAATTATTAAAACCAGCA
    CATGAAAGAAAATCACCAGAAAAAATCAAAGAAGAATTAGATAAAAAAGAAGGCCACTAG
    60
    120
    180
    240
    300
    360
    420

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2372 [new locus tag: NWMN_RS13665 ]
  • symbol: NWMN_2372
  • description: hypothetical protein
  • length: 139
  • theoretical pI: 8.22284
  • theoretical MW: 16097.4
  • GRAVY: -0.716547

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsD-galactonate transporter (TIGR00893; HMM-score: 11.2)
  • TheSEED:  
    FIG01108221: hypothetical protein 
  • PFAM:
    no clan definedDUF1433; Protein of unknown function (DUF1433) (PF07252; HMM-score: 136)
    GAPT; GRB2-binding adapter (GAPT) (PF11770; HMM-score: 15.1)
    Shisa; Wnt and FGF inhibitory regulator (PF13908; HMM-score: 14.1)
    Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 11.2)
    Holin-II (CL0563) Phage_holin_2_3; Bacteriophage holin family HP1 (PF16080; HMM-score: 9.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: 2
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: Signal peptide length 26 aa
    • Ymax: 0.36
    • Ymax_pos: 26
    • Cmax: 0.21
    • Cmax_pos: 26
    • Smax: 0.743
    • Smax_pos: 18
    • Smean: 0.62
    • D: 0.461
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSKKHVFIIIGVILCICTVSTVMHFKMKYDEKEKQKAIYYKEQQERITLYLKHNTKETNTIKSVHFTNLETSPMGSAVIEGYINENKEDDFTAYASPEHNYQFGGAMIKSEGVDKLLKPAHERKSPEKIKEELDKKEGH

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]