From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN006040000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 6094539..6097058
  • synteny block?: BlockID0047840
  • occurrence?: in 50% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    C248_2526
    11819-97:
    71193:
    ST398NM01_2526
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    JH1:
    JH9:
    JKD6008:
    SAA6008_02516
    JKD6159:
    LGA251:
    SARLGA251_22630
    M013:
    MRSA252:
    SAR2562
    MSHR1132:
    SAMSHR1132_23000
    MSSA476:
    Mu3:
    Mu50:
    MW2:
    RF122:
    ST398:
    SAPIG2526
    T0131:
    SAT0131_02674 (tsf)
    TCH60:
    HMPREF0772_10714
    TW20:
    SATW20_26030
    USA300_TCH1516:
    USA300HOU_2466
    VC40:
    SAVC_11250

Genome Viewer[edit source | edit]

COL chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSKKHVFIIIGVILCICTVSTVMHFKMKYDEKEKQKAIYYKEQQERITLYLKHNTKETNT
    NCTC8325        MSKKHVFIIIGVILCICTVSTVMHFKMKYDEKEKQKAIYYKEQQERITLYLKHNTKETNT
    Newman          MSKKHVFIIIGVILCICTVSTVMHFKMKYDEKEKQKAIYYKEQQERITLYLKHNTKETNT
    USA300_FPR3757  MSKKHVFIIIGVILCICTVSTVMHFKMKYDEKEKQKAIYYKEQQERITLYLKHNTKETNT
                    ************************************************************

    COL             IKSVHFTNLETSPMGSAVIEGYINENKEDDFTAYASPEHNYQFGGAMIKSEGVDKLLKPA
    NCTC8325        IKSVHFTNLETSPMGSAVIEGYINENKEDDFTAYASPEHNYQFGGAMIKSEGVDKLLKPA
    Newman          IKSVHFTNLETSPMGSAVIEGYINENKEDDFTAYASPEHNYQFGGAMIKSEGVDKLLKPA
    USA300_FPR3757  IKSVHFTNLETSPMGSAVIEGYINENKEDDFTAYASPEHNYQFGGAMIKSEGVDKLLKPA
                    ************************************************************

    COL             HERKSPEKIKEELDKKEGH
    NCTC8325        HERKSPEKIKEELDKKEGH
    Newman          HERKSPEKIKEELDKKEGH
    USA300_FPR3757  HERKSPEKIKEELDKKEGH
                    *******************