From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2381 [new locus tag: NWMN_RS13715 ]
  • pan locus tag?: SAUPAN006070000
  • symbol: NWMN_2381
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2381 [new locus tag: NWMN_RS13715 ]
  • symbol: NWMN_2381
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2616136..2616462
  • length: 327
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGTTTACTACGTATAAAAATATTAATGAACTTGAAAATGCCTATGATGAAGAAAGAAAA
    CAATTGAATGATGCATTCAATCAAATTGATGAATTAAGACATCAAACACGCAAGAAATGT
    GAACAAATGTATGATCATTTCTTATATCTCAAACATAAAATGAATTATAGTGAAGACGCT
    ATGATCAGGATGACACGTATTATAGAATCTTTCGATAGAGAAACGAATCAACGTATCCGA
    CATCACGAAATGAAATTAGAAGATTATAAAGATGAGTTAAGAAGAGAATATCTAAAACAA
    TCTGACAGAATTGAAGGAGATGAATAA
    60
    120
    180
    240
    300
    327

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2381 [new locus tag: NWMN_RS13715 ]
  • symbol: NWMN_2381
  • description: hypothetical protein
  • length: 108
  • theoretical pI: 5.63959
  • theoretical MW: 13586.1
  • GRAVY: -1.45

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    two transmembrane protein (TIGR04527; HMM-score: 9.7)
    Genetic information processingDNA metabolismDegradation of DNAexodeoxyribonuclease VII, large subunit (TIGR00237; EC 3.1.11.6; HMM-score: 7.2)
    Genetic information processingProtein fateProtein folding and stabilizationchaperone protein DnaK (TIGR02350; HMM-score: 6.9)
    variant surface antigen, rifin family (TIGR01477; HMM-score: 5.3)
  • TheSEED:  
    FIG01107979: hypothetical protein 
  • PFAM:
    VPS23_C (CL0596) Mod_r; Modifier of rudimentary (Mod(r)) protein (PF07200; HMM-score: 15.7)
    no clan definedJnk-SapK_ap_N; JNK_SAPK-associated protein-1 (PF09744; HMM-score: 15.4)
    AATF-Che1; Apoptosis antagonizing transcription factor (PF13339; HMM-score: 13.6)
    Exonuc_VII_L; Exonuclease VII, large subunit (PF02601; HMM-score: 12.8)
    HUP (CL0039) CDPS; Cyclodipeptide synthase (PF16715; HMM-score: 11.9)
    no clan definedDUF1043; Protein of unknown function (DUF1043) (PF06295; HMM-score: 11.6)
    SWIRM-assoc_1; SWIRM-associated region 1 (PF16495; HMM-score: 11.6)
    Fib_alpha; Fibrinogen alpha/beta chain family (PF08702; HMM-score: 10.8)
    Spc24; Spc24 subunit of Ndc80 (PF08286; HMM-score: 10.7)
    DUF4407; Domain of unknown function (DUF4407) (PF14362; HMM-score: 10.2)
    V_ATPase_I; V-type ATPase 116kDa subunit family (PF01496; HMM-score: 7.7)
    FliD_C; Flagellar hook-associated protein 2 C-terminus (PF07195; HMM-score: 7.4)
    FapA; Flagellar Assembly Protein A (PF03961; HMM-score: 6.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.113
    • Ymax_pos: 17
    • Cmax: 0.114
    • Cmax_pos: 17
    • Smax: 0.146
    • Smax_pos: 7
    • Smean: 0.101
    • D: 0.108
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MFTTYKNINELENAYDEERKQLNDAFNQIDELRHQTRKKCEQMYDHFLYLKHKMNYSEDAMIRMTRIIESFDRETNQRIRHHEMKLEDYKDELRREYLKQSDRIEGDE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]