From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2468 [new locus tag: NWMN_RS14175 ]
  • pan locus tag?: SAUPAN006233000
  • symbol: NWMN_2468
  • pan gene symbol?:
  • synonym:
  • product: acetyltransferase, GNAT family protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2468 [new locus tag: NWMN_RS14175 ]
  • symbol: NWMN_2468
  • product: acetyltransferase, GNAT family protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2717403..2717891
  • length: 489
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGGCTATAAACATAATTGAATATAATAGGTCTTATAAGGAAGAGCTAATCGAGTTTATT
    TTATCGATTCAAAAAAATGAATTTAATATAAAAATTGATAGAGATGATCAACCTGATTTG
    GAGAACATCGAACATAACTATTTGAATAATGGAGGGCAATTTTGGCTTGCAATAAACAAT
    CATCAAAATATTGTTGGTACTATAGGTTTGATTAGACTAGATAATAATATGTCTGCACTT
    AAAAAAATGTTTGTTGATAAAGGTTATAGGAATTTAAAAATAGGTAAAAAACTTTTAGAT
    AAAGTTATAATGACATGTAAAGAACAAAATATCGATGGTATTTATTTAGGAACAATTGAT
    AAATTTATTAGTGCACAGTATTTTTATTCTAATAATGGCTTCCGTGAAATTAAGCGAGGA
    GATTTACCAAGTAGTTTTCCTAAATTAGATGTAGATAATAGGTTTTATTACAGAAATTTA
    AAAGATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    489

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2468 [new locus tag: NWMN_RS14175 ]
  • symbol: NWMN_2468
  • description: acetyltransferase, GNAT family protein
  • length: 162
  • theoretical pI: 8.37632
  • theoretical MW: 19082.7
  • GRAVY: -0.544444

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal-protein-alanine acetyltransferase (TIGR01575; EC 2.3.1.128; HMM-score: 38.5)
  • TheSEED:  
    Acetyltransferase (GNAT) family protein 
  • PFAM:
    Acetyltrans (CL0257) Acetyltransf_10; Acetyltransferase (GNAT) domain (PF13673; HMM-score: 45.5)
    Acetyltransf_7; Acetyltransferase (GNAT) domain (PF13508; HMM-score: 41.9)
    Acetyltransf_1; Acetyltransferase (GNAT) family (PF00583; HMM-score: 40.2)
    Acetyltransf_4; Acetyltransferase (GNAT) domain (PF13420; HMM-score: 31.3)
    Acetyltransf_15; Putative acetyl-transferase (PF17013; HMM-score: 17.2)
    Thioredoxin (CL0172) Thioredox_DsbH; Protein of unknown function, DUF255 (PF03190; HMM-score: 14)
    Acetyltrans (CL0257) Acetyltransf_9; Acetyltransferase (GNAT) domain (PF13527; HMM-score: 12.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.111
    • Ymax_pos: 37
    • Cmax: 0.106
    • Cmax_pos: 14
    • Smax: 0.164
    • Smax_pos: 34
    • Smean: 0.094
    • D: 0.104
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MAINIIEYNRSYKEELIEFILSIQKNEFNIKIDRDDQPDLENIEHNYLNNGGQFWLAINNHQNIVGTIGLIRLDNNMSALKKMFVDKGYRNLKIGKKLLDKVIMTCKEQNIDGIYLGTIDKFISAQYFYSNNGFREIKRGDLPSSFPKLDVDNRFYYRNLKD

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]