From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006233000
  • symbol?:
  • description?: pseudogene

      descriptions from strain specific annotations:

    • pseudogene
    • acetyltransferase
    • acetyltransferase (GNAT) family protein
    • acetyltransferase, GNAT family protein
    • GNAT family acetyltransferase
  • strand?: -
  • coordinates?: 6298152..6298640
  • synteny block?: BlockID0049570
  • occurrence?: in 66% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2505
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ECTR2_2421
    ED133:
    ED98:
    SAAV_2634
    HO 5096 0412:
    SAEMRSA15_24710
    JH1:
    SaurJH1_2645
    JH9:
    SaurJH9_2590
    JKD6008:
    JKD6159:
    LGA251:
    SARLGA251_23430
    M013:
    M013TW_2542
    MRSA252:
    MSHR1132:
    SAMSHR1132_23840
    MSSA476:
    SAS2454
    Mu3:
    SAHV_2552
    Mu50:
    SAV2568
    MW2:
    MW2489
    RF122:
    SAB2442c
    ST398:
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_2563
    VC40:
    SAVC_11720

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAINIIEYNRSYKEELIEFILSIQKNEFNIKIDRDDQPDLENIEHNYLNNGGQFWLAINN
    N315            MAINIIEYNRSYKEELIEFILSIQKNEFNIKIDRDDQPDLENIEHNYLNSGGQFWLAINN
    NCTC8325        MAINIIEYNRSYKEELIEFILSIQKNEFNIKIDRDDQPDLENIEHNYLNNGGQFWLAINN
    Newman          MAINIIEYNRSYKEELIEFILSIQKNEFNIKIDRDDQPDLENIEHNYLNNGGQFWLAINN
    USA300_FPR3757  MAINIIEYNRSYKEELIEFILSIQKNEFNIKIDRDDQPDLENIEHNYLNNGGQFWLAINN
                    *************************************************.**********

    COL             HQNIVGTIGLIRLDNNMSALKKMFVDKGYRNLKIGKKLLDKVIMTCKEQNIDGIYLGTID
    N315            HQNIVGTIGLIRLDNNMSALKKMFVDKGYRNLKIGKKLLDKVIMTCKEQNIDGIYLGTID
    NCTC8325        HQNIVGTIGLIRLDNNMSALKKMFVDKGYRNLKIGKKLLDKVIMTCKEQNIDGIYLGTID
    Newman          HQNIVGTIGLIRLDNNMSALKKMFVDKGYRNLKIGKKLLDKVIMTCKEQNIDGIYLGTID
    USA300_FPR3757  HQNIVGTIGLIRLDNNMSALKKMFVDKGYRNLKIGKKLLDKVIMTCKEQNIDGIYLGTID
                    ************************************************************

    COL             KFISAQYFYSNNGFREIKRGDLPSSFPKLDVDNRFYYRNLKD
    N315            KFISAQYFYSNNGFREIKRGDLPSSFPKLDVDNRFYYRNLKD
    NCTC8325        KFISAQYFYSNNDFREIKRGDLPSSFPKLDVDNRFYYRNLKD
    Newman          KFISAQYFYSNNGFREIKRGDLPSSFPKLDVDNRFYYRNLKD
    USA300_FPR3757  KFISAQYFYSNNGFREIKRGDLPSSFPKLDVDNRFYYRNLKD
                    ************.*****************************