From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2563 [new locus tag: NWMN_RS14710 ]
  • pan locus tag?: SAUPAN006409000
  • symbol: capA
  • pan gene symbol?: cap1A
  • synonym:
  • product: capsular polysaccharide biosynthesis protein CapA

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2563 [new locus tag: NWMN_RS14710 ]
  • symbol: capA
  • product: capsular polysaccharide biosynthesis protein CapA
  • replicon: chromosome
  • strand: -
  • coordinates: 2830532..2831194
  • length: 663
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAAAGAAAAGTTTGATTTAGTAAAACTATTAAATATTCTAAAGAAGAATATTAAATTA
    TTGCTTATTTTACCGGCAATATGTCTTGTAGTAAGTGCGGCATTAACCTTTTTTGTTATG
    CCTGACAAATATACTGCTTCTACTCAAATATTAGTGAACATGAAAAAGTCCTCAAGTGAT
    TTAGCTTTCCAAAATGTTCAAAGTAGTTTGCAGTCTGTTAATACATATACGGAAATTATC
    AAAAGTCCTAGAATTCTAGATAAAGTATCTAGAGAATTTGATGGTCAGTATTCAACAGCT
    GAGTTGAATTCATTTTTAAAAGTAACCAATCAAACAAACTCTCAAATTATTACTGTATCA
    GTTACCACTGGGAATAAATCTGAATCTGACAAAATTGTTAATAAAATATCTAAAGTTTTT
    GCTCATGACATGCCTAAAATTATGAGTGTTGATAATGTTACGATACTTTCCTCAGCACAT
    GATAATGCTGTAAAAGTATCTCCAATAGTATCTGTCAACTTAGTTATCAGCATTATTGTT
    GGTATTGTTTTAGCAATATTGATTATTTTCTTAAAAGAATTATTAGATAAGCGTATTAAG
    ACAGAAGAAGATGTTGAATCGCAACTAGGATTACCTATTTTAGGTTCAATACAAAAATTT
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    663

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2563 [new locus tag: NWMN_RS14710 ]
  • symbol: CapA
  • description: capsular polysaccharide biosynthesis protein CapA
  • length: 220
  • theoretical pI: 9.8166
  • theoretical MW: 24339.5
  • GRAVY: 0.299091

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidspolysaccharide export protein, MPA1 family (TIGR01006; HMM-score: 240.8)
    chain length determinant protein EpsF (TIGR03017; HMM-score: 55.7)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsexopolysaccharide transport protein family (TIGR01005; HMM-score: 41.8)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidespolysaccharide chain length determinant protein, PEP-CTERM locus subfamily (TIGR03007; HMM-score: 29.4)
    NDMA-dependent methanol dehydrogenase (TIGR04266; EC 1.1.99.37; HMM-score: 15.4)
  • TheSEED:  
    Cell Wall and CapsuleCapsular and extracellular polysacchridesExopolysaccharide Biosynthesis Tyrosine-protein kinase transmembrane modulator EpsC 
    Regulation and Cell signalingRegulation and Cell signaling - no subcategoryCell envelope-associated LytR-CpsA-Psr transcriptional attenuators Tyrosine-protein kinase transmembrane modulator EpsC 
  • PFAM:
    no clan definedWzz; Chain length determinant protein (PF02706; HMM-score: 82.6)
    GNVR; G-rich domain on putative tyrosine kinase (PF13807; HMM-score: 20.1)
    Amnionless; Amnionless (PF14828; HMM-score: 13.9)
    DUF2975; Protein of unknown function (DUF2975) (PF11188; HMM-score: 13.7)
    CD34_antigen; CD34/Podocalyxin family (PF06365; HMM-score: 12.6)
    VSA (CL0656) RIFIN; Rifin (PF02009; HMM-score: 11.1)
    FUSC (CL0307) FUSC; Fusaric acid resistance protein family (PF04632; HMM-score: 8.8)
    no clan definedDUF5362; Family of unknown function (DUF5362) (PF17319; HMM-score: 8.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 2
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: 0
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.337
    • Ymax_pos: 47
    • Cmax: 0.412
    • Cmax_pos: 47
    • Smax: 0.59
    • Smax_pos: 29
    • Smean: 0.349
    • D: 0.342
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKEKFDLVKLLNILKKNIKLLLILPAICLVVSAALTFFVMPDKYTASTQILVNMKKSSSDLAFQNVQSSLQSVNTYTEIIKSPRILDKVSREFDGQYSTAELNSFLKVTNQTNSQIITVSVTTGNKSESDKIVNKISKVFAHDMPKIMSVDNVTILSSAHDNAVKVSPIVSVNLVISIIVGIVLAILIIFLKELLDKRIKTEEDVESQLGLPILGSIQKF

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]