From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006409000
  • symbol?: cap1A
  • description?: capsular polysaccharide synthesis protein CapA

      descriptions from strain specific annotations:

    • capsular polysaccharide synthesis protein CapA
    • capsular polysaccharide biosynthesis protein
    • lipopolysaccharide biosynthesis protein
    • capsular polysaccharide biosynthesis protein Cap1A
    • Capsular polysaccharide biosynthesis protein capA
    • chain length determinant family protein
    • capsule synthesis protein
    • membrane protein CapA1
    • chain length regulator (capsular polysaccharide biosynthesis)
    • putative capsule synthesis protein
    • autoinducer sensor protein response regulator protein
    • Tyrosine- protein kinase transmembrane modulatorEpsC
  • strand?: -
  • coordinates?: 6458794..6459456
  • synteny block?: BlockID0051160
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2687 (cap1A)
    N315:
    NCTC8325:
    Newman:
    NWMN_2563 (capA)
    USA300_FPR3757:
    SAUSA300_2598 (cap1A)
    04-02981:
    SA2981_2603 (capA)
    08BA02176:
    C248_2734
    11819-97:
    MS7_2669
    71193:
    ST398NM01_2716
    ECT-R 2:
    ECTR2_2518
    ED133:
    SAOV_2716c
    ED98:
    SAAV_2736 (cap1A)
    HO 5096 0412:
    SAEMRSA15_25710
    JH1:
    SaurJH1_2745
    JH9:
    SaurJH9_2688
    JKD6008:
    SAA6008_02724 (cap1A)
    JKD6159:
    SAA6159_02560 (cap1A)
    LGA251:
    SARLGA251_24380
    M013:
    M013TW_2647
    MRSA252:
    SAR2745
    MSHR1132:
    SAMSHR1132_24920
    MSSA476:
    SAS2550
    Mu3:
    SAHV_2648
    Mu50:
    SAV2664
    MW2:
    MW2584 (capA)
    RF122:
    SAB2539c
    ST398:
    SAPIG2716
    T0131:
    SAT0131_02943
    TCH60:
    HMPREF0772_10522 (cap1A)
    TW20:
    SATW20_28020
    USA300_TCH1516:
    USA300HOU_2664 (capA)
    VC40:
    SAVC_12200

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKEKFDLVKLLNILKKNIKLLLILPAICLVVSAALTFFVMPDKYTASTQILVNMKKSSSD
    N315            MKEKFDLVKLLNILKKNIKLLLILPAICLVVSTALTFFVMPDKYTASTQILVNMKKSSSD
    NCTC8325        MKEKFDLVKLLNILKKNIKLLLILPAICLVVSAALTFFVMPDKYTASTQILVNMKKSSSD
    Newman          MKEKFDLVKLLNILKKNIKLLLILPAICLVVSAALTFFVMPDKYTASTQILVNMKKSSSD
    USA300_FPR3757  MKEKFDLVKLLNILKKNIKLLLILPAICLVVSAALTFFVMPDKYTASTQILVNMKKSSSD
                    ********************************:***************************

    COL             LAFQNVQSSLQSVNTYTEIIKSPRILDKVSREFDGQYSTAELNSFLKVTNQTNSQIITVS
    N315            LAFQNVQSSLQSVNTYTEIIKSPRILDKVSREFDGQYSTAELNSFLKVTNQTNSQIITVS
    NCTC8325        LAFQNVQSSLQSVNTYTEIIKSPRILDKVSREFDGQYSTAELNSFLKVTNQTNSQIITVS
    Newman          LAFQNVQSSLQSVNTYTEIIKSPRILDKVSREFDGQYSTAELNSFLKVTNQTNSQIITVS
    USA300_FPR3757  LAFQNVQSSLQSVNTYTEIIKSPRILDKVSREFDGQYSTAELNSFLKVTNQTNSQIITVS
                    ************************************************************

    COL             VTTGNKSESDKIVNKISKVFAHDMPKIMSVDNVTILSSAHDNAVKVSPIVSVNLVISIIV
    N315            VTTGNKSESDKIVNRISKVFAHDMPKIMSVDNVTILSSAHDNAVKVSPIVSVNLVISIIV
    NCTC8325        VTTGNKSESDKIVNKISKVFAHDMPKIMSVDNVTILSSAHDNAVKVSPIVSVNLVISIIV
    Newman          VTTGNKSESDKIVNKISKVFAHDMPKIMSVDNVTILSSAHDNAVKVSPIVSVNLVISIIV
    USA300_FPR3757  VTTGNKSESDKIVNKISKVFAHDMPKIMSVDNVTILSSAHDNAVKVSPIVSVNLVISIIV
                    **************:*********************************************

    COL             GIVLAILIIFLKELLDKRIKTEEDVESQLGLPILGSIQKF
    N315            GIVLAILIIFLKELLDKRIKTEEDVESQLGLPILGSIQKF
    NCTC8325        GIVLAILIIFLKELLDKRIKTEEDVESQLGLPILGSIQKF
    Newman          GIVLAILIIFLKELLDKRIKTEEDVESQLGLPILGSIQKF
    USA300_FPR3757  GIVLAILIIFLKELLDKRIKTEEDVESQLGLPILGSIQKF
                    ****************************************