From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2572 [new locus tag: NWMN_RS14760 ]
  • pan locus tag?: SAUPAN006429000
  • symbol: hisA
  • pan gene symbol?: hisA
  • synonym:
  • product: 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2572 [new locus tag: NWMN_RS14760 ]
  • symbol: hisA
  • product: 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
  • replicon: chromosome
  • strand: -
  • coordinates: 2841092..2841796
  • length: 705
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGATTGAATTATGGCCAGCGATTGATTTGATTGGGTCAACAAGTGTGAGGTTAACAGAG
    GGTAAATATGATAGTGAAGAAAAAATGTCACGCTCGGCTGAAGAAAGTATTGCTTACTAT
    AGTCAATTTGAATGTGTGAATCGTATTCATATCGTCGACTTGATAGGTGCTAAGGCACAG
    CATGCCCGAGAGTTTGATTATATTAAGTCATTGAGGAGATTAACAACCAAAGATATTGAA
    GTAGGTGGTGGCATTCGTACGAAGTCACAAATCATGGACTACTTTGCCGCAGGGATTAAT
    TATTGCATAGTTGGAACGAAAGGTATTCAAGATACTGATTGGCTTAAAGAGATGGCACAT
    ACATTTCCAGGTCGCATTTATTTATCTGTTGATGCCTATGGAGAAGATATTAAAGTGAAC
    GGATGGGAAGAGGACACAGAGTTAAATTTATTTAGTTTTGTGAGACGGTTATCGGATATA
    CCTCTTGGCGGCATTATATATACTGATATTGCTAAAGATGGCAAAATGTCCGGACCTAAC
    TTTGAATTAACTGGTCAATTAGTAAAGGCAACGACGATTCCTGTCATTGCTTCCGGTGGT
    ATTAGACATCAGCAAGATATTCAACGATTAGCGTCGCTAAATGTTCACGCTGCTATTATA
    GGAAAGGCTGCACATCAAGCATCTTTTTGGGAGGGGCTAAAATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    705

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2572 [new locus tag: NWMN_RS14760 ]
  • symbol: HisA
  • description: 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
  • length: 234
  • theoretical pI: 5.9599
  • theoretical MW: 26090.5
  • GRAVY: -0.185897

Function[edit source | edit]

  • reaction:
    EC 5.3.1.16?  ExPASy
    1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase1-(5-phospho-beta-D-ribosyl)-5-((5-phospho-beta-D-ribosylamino)methylideneamino)imidazole-4-carboxamide = 5-((5-phospho-1-deoxy-D-ribulos-1-ylamino)methylideneamino)-1-(5-phospho-beta-D-ribosyl)imidazole-4-carboxamide
  • TIGRFAM:
    MetabolismAmino acid biosynthesisHistidine family1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase (TIGR00007; EC 5.3.1.16; HMM-score: 248.4)
    bifunctional HisA/TrpF protein (TIGR01919; EC 5.3.1.16,5.3.1.24; HMM-score: 107)
    glycosyl amidation-associated protein WbuZ (TIGR03572; HMM-score: 76.1)
    MetabolismAmino acid biosynthesisHistidine familyimidazoleglycerol phosphate synthase, cyclase subunit (TIGR00735; HMM-score: 63.7)
    Unknown functionGeneralhisA/hisF family protein (TIGR00734; HMM-score: 49)
    MetabolismAmino acid biosynthesisAromatic amino acid familytryptophan synthase, alpha subunit (TIGR00262; EC 4.2.1.20; HMM-score: 18.1)
    MetabolismAmino acid biosynthesisHistidine familyphosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (TIGR02129; EC 5.3.1.16; HMM-score: 17.4)
    MetabolismEnergy metabolismOtherdeoxyribose-phosphate aldolase (TIGR00126; EC 4.1.2.4; HMM-score: 15.3)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesOtherdeoxyribose-phosphate aldolase (TIGR00126; EC 4.1.2.4; HMM-score: 15.3)
    geranylgeranylglyceryl phosphate synthase family protein (TIGR01768; EC 2.5.1.-; HMM-score: 14)
    putative enoyl-[acyl-carrier-protein] reductase II (TIGR03151; EC 1.3.1.-; HMM-score: 13.3)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersThiaminethiamine-phosphate diphosphorylase (TIGR00693; EC 2.5.1.3; HMM-score: 13.1)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisinosine-5'-monophosphate dehydrogenase (TIGR01302; EC 1.1.1.205; HMM-score: 12.9)
    phosphoglycerol geranylgeranyltransferase (TIGR01769; EC 2.5.1.41; HMM-score: 12.3)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesNucleotide and nucleoside interconversionsguanosine monophosphate reductase (TIGR01306; EC 1.7.1.7; HMM-score: 12)
    dihydroorotate dehydrogenase family protein (TIGR01037; EC 1.3.-.-; HMM-score: 11.5)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtherisopentenyl-diphosphate delta-isomerase, type 2 (TIGR02151; EC 5.3.3.2; HMM-score: 10.7)
  • TheSEED:  
    Amino Acids and DerivativesAromatic amino acids and derivativesTryptophan synthesis Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (EC 5.3.1.16) 
    Histidine MetabolismHistidine Biosynthesis in plants Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (EC 5.3.1.16) 
    Histidine MetabolismHistidine Biosynthesis Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (EC 5.3.1.16) 
  • PFAM:
    TIM_barrel (CL0036) His_biosynth; Histidine biosynthesis protein (PF00977; HMM-score: 209.6)
    TMP-TENI; Thiamine monophosphate synthase (PF02581; HMM-score: 23.1)
    NMO; Nitronate monooxygenase (PF03060; HMM-score: 18.7)
    G3P_antiterm; Glycerol-3-phosphate responsive antiterminator (PF04309; HMM-score: 17.3)
    IMPDH; IMP dehydrogenase / GMP reductase domain (PF00478; HMM-score: 16.6)
    IGPS; Indole-3-glycerol phosphate synthase (PF00218; HMM-score: 16.2)
    Dus; Dihydrouridine synthase (Dus) (PF01207; HMM-score: 15.5)
    DHO_dh; Dihydroorotate dehydrogenase (PF01180; HMM-score: 14.9)
    Trp_syntA; Tryptophan synthase alpha chain (PF00290; HMM-score: 14.4)
    QRPTase_C; Quinolinate phosphoribosyl transferase, C-terminal domain (PF01729; HMM-score: 14.3)
    FMN_dh; FMN-dependent dehydrogenase (PF01070; HMM-score: 13.7)
    PcrB; PcrB family (PF01884; HMM-score: 13.1)
    NanE; Putative N-acetylmannosamine-6-phosphate epimerase (PF04131; HMM-score: 11.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.119
    • Ymax_pos: 33
    • Cmax: 0.127
    • Cmax_pos: 60
    • Smax: 0.143
    • Smax_pos: 22
    • Smean: 0.096
    • D: 0.11
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MIELWPAIDLIGSTSVRLTEGKYDSEEKMSRSAEESIAYYSQFECVNRIHIVDLIGAKAQHAREFDYIKSLRRLTTKDIEVGGGIRTKSQIMDYFAAGINYCIVGTKGIQDTDWLKEMAHTFPGRIYLSVDAYGEDIKVNGWEEDTELNLFSFVRRLSDIPLGGIIYTDIAKDGKMSGPNFELTGQLVKATTIPVIASGGIRHQQDIQRLASLNVHAAIIGKAAHQASFWEGLK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulators: NWMN_1845 (HisR*), CodY
    HisR* (TF) important in Histidine biosynthesis
    CodY (TF) important in Amino acid metabolism

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]