From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2583 [new locus tag: NWMN_RS14815 ]
  • pan locus tag?: SAUPAN006441000
  • symbol: NWMN_2583
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2583 [new locus tag: NWMN_RS14815 ]
  • symbol: NWMN_2583
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2851319..2851873
  • length: 555
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAAAAAACAAGATATTTCAGTTAAAACTGTTGTTGCAATTGGTATAGGAGCAGCGGTA
    TTTGTAATTTTAGGGCGTTTTGTTGTAATACCAACAGGTTTTCCTAATACGAATATAGAA
    ACATCATATGCATTTTTAGCATTAATATCTGCAATATTTGGACCTTTTGCTGGTTTAATG
    ACTGGATTAGTTGGACATGCTATTAAAGATTTTACGACATACGGTAGTGCCTGGTGGAGT
    TGGGTTATTTGCTCGGGAATTATAGGCTGTTTATATGGCTGGATTGGACTAAAATTAAAT
    CTTTCTTCAGGCCGATTTTCTAGGAAATCGATGGTTTATTTTAATATCGGTCAAATTATT
    GCGAATATTATTTGCTGGGCACTTATTGCACCAACATTAGATATTTTGATTTATAACGAA
    CCAGCTAACAAGGTTTATACACAAGGTGTTATCTCTGCAGTATTAAATATTATTTCAGTT
    GGCATTATTGGGACAATATTATTAAAAGCATATGCTTCATCTCAAATTAAAAAAGGTAGT
    TTACGTAAGGAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    555

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2583 [new locus tag: NWMN_RS14815 ]
  • symbol: NWMN_2583
  • description: hypothetical protein
  • length: 184
  • theoretical pI: 10.0688
  • theoretical MW: 19839.4
  • GRAVY: 0.747283

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsUnknown substrateECF transporter S component, folate family (TIGR04518; HMM-score: 36.9)
  • TheSEED:  
    Amino Acids and DerivativesLysine, threonine, methionine, and cysteineMethionine Biosynthesis Substrate-specific component MtsA of methionine-regulated ECF transporter 
    Membrane TransportMembrane Transport - no subcategoryECF class transporters Substrate-specific component MtsA of methionine-regulated ECF transporter 
  • PFAM:
    Gx_transp (CL0315) ECF-ribofla_trS; ECF-type riboflavin transporter, S component (PF07155; HMM-score: 173.3)
    ECF_trnsprt; ECF transporter, substrate-specific component (PF12822; HMM-score: 30.7)
    no clan definedGlycophorin_A; Glycophorin A (PF01102; HMM-score: 12.7)
    DUF3021; Protein of unknown function (DUF3021) (PF11457; HMM-score: 7.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 5
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: 0
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.207
    • Ymax_pos: 30
    • Cmax: 0.141
    • Cmax_pos: 45
    • Smax: 0.536
    • Smax_pos: 25
    • Smean: 0.307
    • D: 0.246
  • predicted transmembrane helices (TMHMM): 5

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKKQDISVKTVVAIGIGAAVFVILGRFVVIPTGFPNTNIETSYAFLALISAIFGPFAGLMTGLVGHAIKDFTTYGSAWWSWVICSGIIGCLYGWIGLKLNLSSGRFSRKSMVYFNIGQIIANIICWALIAPTLDILIYNEPANKVYTQGVISAVLNIISVGIIGTILLKAYASSQIKKGSLRKE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]