From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS00130 [old locus tag: NWMN_0023 ]
  • pan locus tag?: SAUPAN000040000
  • symbol: NWMN_RS00130
  • pan gene symbol?: orfX
  • synonym:
  • product: 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS00130 [old locus tag: NWMN_0023 ]
  • symbol: NWMN_RS00130
  • product: 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH
  • replicon: chromosome
  • strand: +
  • coordinates: 33692..34171
  • length: 480
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (33692..34171) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAAAATCACCATTTTAGCTGTAGGGAAACTAAAAGAGAAATATTGGAAGCAAGCCATA
    GCAGAATATGAAAAACGTTTAGGCCCATACACCAAGATAGACATCATAGAAGTTCCAGAC
    GAAAAAGCACCAGAAAATATGAGTGACAAAGAAATTGAGCAAGTAAAAGAAAAAGAAGGC
    CAACGAATACTAGCCAAAATCAAACCACAATCCACAGTCATTACATTAGAAATACAAGGA
    AAGATGCTATCTTCCGAAGGATTGGCCCAAGAATTGAACCAACGCATGACCCAAGGGCAA
    AGCGACTTTGTTTTCGTCATTGGCGGATCAAACGGCCTGCACAAGGACGTCTTACAACGC
    AGTAACTACGCACTATCATTCAGCAAAATGACATTCCCACATCAAATGATGCGGGTTGTG
    TTAATTGAACAAGTGTACAGAGCATTTAAGATTATGCGAGGAGAGGCGTATCATAAGTAA
    60
    120
    180
    240
    300
    360
    420
    480

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS00130 [old locus tag: NWMN_0023 ]
  • symbol: NWMN_RS00130
  • description: 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH
  • length: 159
  • theoretical pI: 9.85885
  • theoretical MW: 18306.2
  • GRAVY: -0.461635

Function[edit source | edit]

  • reaction:
    EC 2.1.1.177?  ExPASy
    23S rRNA (pseudouridine1915-N3)-methyltransferaseS-adenosyl-L-methionine + pseudouridine1915 in 23S rRNA = S-adenosyl-L-homocysteine + N3-methylpseudouridine1915 in 23S rRNA
  • TIGRFAM:
    Genetic information processingProtein synthesistRNA and rRNA base modificationrRNA large subunit m3Psi methyltransferase RlmH (TIGR00246; EC 2.1.1.177; HMM-score: 186.6)
  • TheSEED:
  • PFAM:
    SPOUT (CL0098) SPOUT_MTase; Predicted SPOUT methyltransferase (PF02590; HMM-score: 206.9)
    Methyltrn_RNA_4; SAM-dependent RNA methyltransferase (PF09936; HMM-score: 16.3)
    no clan definedExbD; Biopolymer transport protein ExbD/TolR (PF02472; HMM-score: 13.2)
    GT-A (CL0110) Glyco_tranf_2_3; Glycosyltransferase like family 2 (PF13641; HMM-score: 12.9)
    no clan definedSCAB-IgPH; Fused Ig-PH domain of plant-specific actin-binding protein (PF16709; HMM-score: 12.5)
    PDDEXK (CL0236) Vsr; DNA mismatch endonuclease Vsr (PF03852; HMM-score: 11.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.123
    • Ymax_pos: 22
    • Cmax: 0.131
    • Cmax_pos: 22
    • Smax: 0.161
    • Smax_pos: 1
    • Smean: 0.119
    • D: 0.121
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446627429 NCBI
  • RefSeq: WP_000704775 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKITILAVGKLKEKYWKQAIAEYEKRLGPYTKIDIIEVPDEKAPENMSDKEIEQVKEKEGQRILAKIKPQSTVITLEIQGKMLSSEGLAQELNQRMTQGQSDFVFVIGGSNGLHKDVLQRSNYALSFSKMTFPHQMMRVVLIEQVYRAFKIMRGEAYHK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS00130 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]