From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS02140 [old locus tag: NWMN_0378 ]
  • pan locus tag?: SAUPAN001994000
  • symbol: NWMN_RS02140
  • pan gene symbol?: xpt
  • synonym:
  • product: xanthine phosphoribosyltransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS02140 [old locus tag: NWMN_0378 ]
  • symbol: NWMN_RS02140
  • product: xanthine phosphoribosyltransferase
  • replicon: chromosome
  • strand: +
  • coordinates: 426067..426645
  • length: 579
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (426067..426645) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    GTGGAGTTACTAGGACAAAAAGTAAAGGAAGACGGCGTTGTCATTGATGAGAAGATTTTA
    AAAGTCGATGGATTTTTAAATCATCAAATTGATGCAAAGTTAATGAATGAAGTTGGTCGC
    ACTTTTTACGAGCAATTTAAAGATAAAGGGATTACTAAAATCTTAACCATTGAAGCTTCC
    GGTATCGCACCTGCAATCATGGCTGCACTGCATTTTGATGTGCCATGTTTATTTGCGAAA
    AAAGCAAAACCTAGCACTTTGACGGATGGTTATTATGAAACATCTATTCATTCATTTACT
    AAAAATAAAACAAGTACGGTCATTGTTTCAAAAGAGTTTTTATCAGAAGAAGATACTGTA
    CTTATCATCGATGACTTTTTAGCAAATGGTGATGCTTCATTAGGATTATACGATATCGCA
    CAGCAAGCGAATGCTAAGACAGCTGGTATTGGTATTGTTGTTGAAAAGAGTTTCCAAAAT
    GGGCATCAACGTTTAGAAGAAGCAGGTTTAACAGTTTCTTCTCTCTGCAAGGTTGCTTCA
    CTAGAAGGAAACAAAGTGACATTGGTGGGAGAAGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    579

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS02140 [old locus tag: NWMN_0378 ]
  • symbol: NWMN_RS02140
  • description: xanthine phosphoribosyltransferase
  • length: 192
  • theoretical pI: 4.79798
  • theoretical MW: 20883.7
  • GRAVY: -0.0328125

Function[edit source | edit]

  • reaction:
    EC 2.4.2.22?  ExPASy
    Xanthine phosphoribosyltransferaseXMP + diphosphate = 5-phospho-alpha-D-ribose 1-diphosphate + xanthine
  • TIGRFAM:
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotidesxanthine phosphoribosyltransferase (TIGR01744; EC 2.4.2.22; HMM-score: 331)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesispur operon repressor PurR (TIGR01743; HMM-score: 55.6)
    Signal transductionRegulatory functionsDNA interactionspur operon repressor PurR (TIGR01743; HMM-score: 55.6)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotidesadenine phosphoribosyltransferase (TIGR01090; EC 2.4.2.7; HMM-score: 40)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPyrimidine ribonucleotide biosynthesisorotate phosphoribosyltransferase (TIGR00336; EC 2.4.2.10; HMM-score: 19.8)
    4-hydroxyphenylacetate 3-monooxygenase, oxygenase component (TIGR02309; EC 1.14.14.9; HMM-score: 11.2)
  • TheSEED:
  • PFAM:
    PRTase-like (CL0533) Pribosyltran; Phosphoribosyl transferase domain (PF00156; HMM-score: 27.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.114
    • Ymax_pos: 69
    • Cmax: 0.113
    • Cmax_pos: 69
    • Smax: 0.139
    • Smax_pos: 60
    • Smean: 0.077
    • D: 0.1
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446343555 NCBI
  • RefSeq: WP_000421410 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MELLGQKVKEDGVVIDEKILKVDGFLNHQIDAKLMNEVGRTFYEQFKDKGITKILTIEASGIAPAIMAALHFDVPCLFAKKAKPSTLTDGYYETSIHSFTKNKTSTVIVSKEFLSEEDTVLIIDDFLANGDASLGLYDIAQQANAKTAGIGIVVEKSFQNGHQRLEEAGLTVSSLCKVASLEGNKVTLVGEE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS02140 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]