From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS02420 [old locus tag: NWMN_0428 ]
  • pan locus tag?: SAUPAN002178000
  • symbol: NWMN_RS02420
  • pan gene symbol?: metQ2
  • synonym:
  • product: ABC transporter substrate-binding protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS02420 [old locus tag: NWMN_0428 ]
  • symbol: NWMN_RS02420
  • product: ABC transporter substrate-binding protein
  • replicon: chromosome
  • strand: +
  • coordinates: 480100..480942
  • length: 843
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (480100..480942) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGAAAAGATTGATTGGGTTAGTTATCGTAGCACTTGTATTATTAGCAGCGTGTGGTGGT
    AACAATGATAAAAAAGTAACAATTGGTGTCGCATCAAATGACACTAAGGCTTGGGAGAAG
    GTTAAAGAATTAGCTAAAAAAGATGATATTGATGTGGAGATTAAGCACTTCTCAGATTAC
    AATTTACCGAATAAAGCATTAAATGATGGTGATATTGATATGAATGCATTCCAACATTTT
    GCATTTTTAGATCAATATAAAAAGGCGCATAAAGGAACAAAGATTTCAGCATTAAGTACA
    ACAGTTTTAGCACCGTTGGGCATTTACTCAGATAAAATTAAAGATGTCAAAAAGGTTAAA
    GATGGTGCTAAAGTTGTCATTCCAAATGATGTGTCAAACCAAGCACGTGCACTTAAACTA
    TTAGAAGCAGCTGGTTTAATAAAACTGAAAAAAGATTTCGGATTAGCAGGCACGGTGAAA
    GATATAACGTCAAATCCAAAACATTTAAAAATTACTGCAGTAGATGCACAACAAACTGCA
    CGTGCTTTATCTGATGTCGATATTGCAGTTATTAATAACGGTGTAGCAACTAAAGCGGGT
    AAAGATCCTAAAAATGATCCGATATTTTTAGAAAAATCAAATTCAGATGCAGTAAAGCCA
    TATATTAATATTGTTGCAGTTAATGACAAAGACTTGGATAACAAAACATATGCTAAAATC
    GTAGAATTGTATCATTCAAAAGAAGCTCAAAAAGCGTTGCAGGAAGATGTCAAAGATGGA
    GAGAAACCTGTTAATTTATCTAAAGATGAGATTAAGGCAATAGAAACGTCATTAGCAAAA
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    843

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS02420 [old locus tag: NWMN_0428 ]
  • symbol: NWMN_RS02420
  • description: ABC transporter substrate-binding protein
  • length: 280
  • theoretical pI: 9.62721
  • theoretical MW: 30455.9
  • GRAVY: -0.315714

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cell structureCell envelopeOtherlipoprotein, YaeC family (TIGR00363; HMM-score: 196.6)
  • TheSEED:
  • PFAM:
    PBP (CL0177) Lipoprotein_9; NLPA lipoprotein (PF03180; HMM-score: 288.4)
    NADP_Rossmann (CL0063) Ldh_1_N; lactate/malate dehydrogenase, NAD binding domain (PF00056; HMM-score: 16.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 9.68
    • Cellwall Score: 0.17
    • Extracellular Score: 0.16
    • Internal Helices: 0
  • LocateP:
  • SignalP: Signal peptide length 26 aa
    • Ymax: 0.359
    • Ymax_pos: 26
    • Cmax: 0.192
    • Cmax_pos: 26
    • Smax: 0.855
    • Smax_pos: 16
    • Smean: 0.721
    • D: 0.5
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446748265 NCBI
  • RefSeq: WP_000825521 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKRLIGLVIVALVLLAACGGNNDKKVTIGVASNDTKAWEKVKELAKKDDIDVEIKHFSDYNLPNKALNDGDIDMNAFQHFAFLDQYKKAHKGTKISALSTTVLAPLGIYSDKIKDVKKVKDGAKVVIPNDVSNQARALKLLEAAGLIKLKKDFGLAGTVKDITSNPKHLKITAVDAQQTARALSDVDIAVINNGVATKAGKDPKNDPIFLEKSNSDAVKPYINIVAVNDKDLDNKTYAKIVELYHSKEAQKALQEDVKDGEKPVNLSKDEIKAIETSLAK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS02420 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]