From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS02485 [old locus tag: NWMN_0440 ]
  • pan locus tag?: SAUPAN002192000
  • symbol: NWMN_RS02485
  • pan gene symbol?: treR
  • synonym:
  • product: trehalose operon repressor

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS02485 [old locus tag: NWMN_0440 ]
  • symbol: NWMN_RS02485
  • product: trehalose operon repressor
  • replicon: chromosome
  • strand: +
  • coordinates: 496965..497693
  • length: 729
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (496965..497693) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGGCGAAACAAAAAAAGTTTATGAAGATTTATGAGGCGTTGAAAGAAGATATATTAAAC
    GGGCAGATTCAATATGGTGAACAAATTCCGTCTGAACATGATTTGGTGCAATTGTACCAG
    TCATCTCGAGAGACCGTGCGTAAGGCATTAGATTTGTTGGCATTAGACGGCATGATTCAA
    AAGATTCATGGTAAAGGGTCACTTGTCATTTATCAGGAGGTTACAGAGTTTCCATTTTCT
    GAACTTGTTAGTTTTAAAGAAATGCAAGAAGAAATGGGCGTCGCATATTTAACTGAAGTT
    GTTGTGAATGAGGTTGTTGAAGCGCATGAAGTTCCAGAAGTTCAACATGCTTTAAACATC
    AATTCTAGTGAATCACTCATTCATATTGTTAGAACTCGTCGGCTTAACCAACATGTGAAG
    ATTGTTGATGAAGATTATTTTCTAAAGTCGATTGTTTCAGATATAGGTAATGATGTTGCG
    AGTGATTCTATTTATGATTATTTGGAAAAGGTATTAAATCTTAATATTAGTTATTCAAGT
    AAGTCTATTACTTTTGAACCGTTTGATGAACAAGCATATCAATTGTTTGGTGATGTATCG
    GTGGCTTATTCAGCAACAGTTCGAAGTATTGTGTATTTAGAAAATACAATGCCGTTTCAA
    TATAATATTTCAAAACATCTTGCAAATGAATTTAAATTTAATGACTTCTCAAGACGTCGT
    ATAAAGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    729

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS02485 [old locus tag: NWMN_0440 ]
  • symbol: NWMN_RS02485
  • description: trehalose operon repressor
  • length: 242
  • theoretical pI: 4.92255
  • theoretical MW: 27962.5
  • GRAVY: -0.266116

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Signal transductionRegulatory functionsDNA interactionstrehalose operon repressor (TIGR02404; HMM-score: 229.5)
    MetabolismTransport and binding proteinsAnionsphosphonate metabolism transcriptional regulator PhnF (TIGR02325; HMM-score: 72.4)
    Signal transductionRegulatory functionsDNA interactionsphosphonate metabolism transcriptional regulator PhnF (TIGR02325; HMM-score: 72.4)
    MetabolismEnergy metabolismAmino acids and amineshistidine utilization repressor (TIGR02018; HMM-score: 62)
    Signal transductionRegulatory functionsDNA interactionshistidine utilization repressor (TIGR02018; HMM-score: 62)
    Signal transductionRegulatory functionsDNA interactionsphosphonate utilization transcriptional regulator PhnR (TIGR03337; HMM-score: 57.1)
    MetabolismFatty acid and phospholipid metabolismBiosynthesisfatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 23.3)
    MetabolismFatty acid and phospholipid metabolismDegradationfatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 23.3)
    Signal transductionRegulatory functionsDNA interactionsfatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 23.3)
    phosphonate utilization associated transcriptional regulator (TIGR03338; HMM-score: 17.4)
    Genetic information processingMobile and extrachromosomal element functionsProphage functionsphage replisome organizer, putative, N-terminal region (TIGR01714; HMM-score: 14.7)
  • TheSEED:
  • PFAM:
    UTRA (CL0122) UTRA; UTRA domain (PF07702; HMM-score: 91.5)
    HTH (CL0123) GntR; Bacterial regulatory proteins, gntR family (PF00392; HMM-score: 60)
    HTH_DeoR; DeoR-like helix-turn-helix domain (PF08220; HMM-score: 20.9)
    HTH_41; Helix-turn-helix domain (PF14502; HMM-score: 14.3)
    Phage_rep_org_N; N-terminal phage replisome organiser (Phage_rep_org_N) (PF09681; HMM-score: 13.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.117
    • Ymax_pos: 11
    • Cmax: 0.117
    • Cmax_pos: 50
    • Smax: 0.218
    • Smax_pos: 4
    • Smean: 0.132
    • D: 0.123
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 447041419 NCBI
  • RefSeq: WP_001118675 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MAKQKKFMKIYEALKEDILNGQIQYGEQIPSEHDLVQLYQSSRETVRKALDLLALDGMIQKIHGKGSLVIYQEVTEFPFSELVSFKEMQEEMGVAYLTEVVVNEVVEAHEVPEVQHALNINSSESLIHIVRTRRLNQHVKIVDEDYFLKSIVSDIGNDVASDSIYDYLEKVLNLNISYSSKSITFEPFDEQAYQLFGDVSVAYSATVRSIVYLENTMPFQYNISKHLANEFKFNDFSRRRIK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS02485 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]