From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS03280 [old locus tag: NWMN_0573 ]
  • pan locus tag?: SAUPAN002466000
  • symbol: NWMN_RS03280
  • pan gene symbol?:
  • synonym:
  • product: flavodoxin family protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS03280 [old locus tag: NWMN_0573 ]
  • symbol: NWMN_RS03280
  • product: flavodoxin family protein
  • replicon: chromosome
  • strand: +
  • coordinates: 654269..654805
  • length: 537
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (654269..654805) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGATTACTGTTTTGTTTGGTGGGAGTAGACCAAACGGTAATACTGCACAATTAACAAAA
    TTCGCTTTGCAAGATTTAGAGTATCAATGGATTGACGTGACACAACATCAGTTTAAACCG
    ATACGTGACGTGAGACATACAGCAGAGACTATTACTTCATATGACGATGACTATTTGCCG
    ATTCTAGATAAAATATTGGCTAGTGATACAATTATTTTTGCATCACCAGTGTATTGGTAT
    AGCATTTCAGCACCATTGAAAGCATTTATCGAACATTGGTCAGAAACATTACAAGATAAA
    CGATATCCTAATTTTAAGGCACAAATGGCCGAAAAGGATTTTAGAGTTATTTTAGTTGGT
    GGAGATTGTCCAAAAATAAAAGCGAAGCCAGCAATTACGCAAATGAAATATAGTTTAGAC
    TTTTTAGGTGCCACTTTAAATGGTTATATTATTGGAACTGCTGAAAAGCCTGGTGACATC
    ATGAAAGACAACTATGCCTTAGCACGTGCAACTGAGTGGAATAGTATATTGCAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    537

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS03280 [old locus tag: NWMN_0573 ]
  • symbol: NWMN_RS03280
  • description: flavodoxin family protein
  • length: 178
  • theoretical pI: 6.26176
  • theoretical MW: 20243
  • GRAVY: -0.241011

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    FMN reductase (TIGR03566; EC 1.5.1.-; HMM-score: 19.4)
    MetabolismCentral intermediary metabolismSulfur metabolismFMN reductase (TIGR03567; EC 1.5.1.38; HMM-score: 19.4)
    LLM-partnered FMN reductase, CE1759 family (TIGR04037; EC 1.-.-.-; HMM-score: 12.1)
  • TheSEED:
  • PFAM:
    Flavoprotein (CL0042) FMN_red; NADPH-dependent FMN reductase (PF03358; HMM-score: 62)
    Flavodoxin_2; Flavodoxin-like fold (PF02525; HMM-score: 44.2)
    Flavodoxin_5; Flavodoxin domain (PF12724; HMM-score: 13.8)
    vWA-like (CL0128) DUF1194; Protein of unknown function (DUF1194) (PF06707; HMM-score: 13.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.143
    • Ymax_pos: 19
    • Cmax: 0.121
    • Cmax_pos: 19
    • Smax: 0.24
    • Smax_pos: 1
    • Smean: 0.17
    • D: 0.154
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446556436 NCBI
  • RefSeq: WP_000633782 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MITVLFGGSRPNGNTAQLTKFALQDLEYQWIDVTQHQFKPIRDVRHTAETITSYDDDYLPILDKILASDTIIFASPVYWYSISAPLKAFIEHWSETLQDKRYPNFKAQMAEKDFRVILVGGDCPKIKAKPAITQMKYSLDFLGATLNGYIIGTAEKPGDIMKDNYALARATEWNSILQ

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS03280 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]