From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS04375 [old locus tag: NWMN_0774 ]
  • pan locus tag?: SAUPAN002819000
  • symbol: NWMN_RS04375
  • pan gene symbol?:
  • synonym:
  • product: thiol reductase thioredoxin

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS04375 [old locus tag: NWMN_0774 ]
  • symbol: NWMN_RS04375
  • product: thiol reductase thioredoxin
  • replicon: chromosome
  • strand: -
  • coordinates: 865828..866148
  • length: 321
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (865828..866148) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGCAATCAATCAAAAGTAATGAATCATTTAAATCTGTAATTAATAGCGATACACCTGTA
    ATTGTTAAATTTGAGGCAGGATGGTGCCCAGACTGTCGTGCTATGGATTTATGGATTGAC
    CCAATCGTAGAACAATATAATGATTACCAATGGTATACTGTTAATCGTGATGAATTAGAA
    GATGTAGTTGTTGAAAATGAAGTTATGGGTATCCCTAGCTTGCTAGTATTTAAAAACGGC
    GATAAAATTGCACACCTTCATTCAGCAAATGCTAAGTCACCTGAACAAGTTGAATCATTT
    TTAGCAGAAACTTTTAAATAA
    60
    120
    180
    240
    300
    321

Protein[edit source | edit]

Protein Data Bank: 4RUV

General[edit source | edit]

  • locus tag: NWMN_RS04375 [old locus tag: NWMN_0774 ]
  • symbol: NWMN_RS04375
  • description: thiol reductase thioredoxin
  • length: 106
  • theoretical pI: 4.22853
  • theoretical MW: 12140.6
  • GRAVY: -0.314151

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismEnergy metabolismElectron transportthioredoxin (TIGR01068; HMM-score: 56.4)
    Genetic information processingProtein fateProtein folding and stabilizationprotein disulfide-isomerase domain (TIGR01126; HMM-score: 34)
    protein disulfide isomerase (TIGR01130; HMM-score: 24.9)
    Genetic information processingProtein fateProtein folding and stabilizationperiplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily (TIGR00385; HMM-score: 13.8)
  • TheSEED:
  • PFAM:
    Thioredoxin (CL0172) Thioredoxin; Thioredoxin (PF00085; HMM-score: 62.8)
    Thioredoxin_2; Thioredoxin-like domain (PF13098; HMM-score: 18.2)
    Thioredoxin_7; Thioredoxin-like (PF13899; HMM-score: 17.3)
    Thioredoxin_8; Thioredoxin-like (PF13905; HMM-score: 17.2)
    Thioredoxin_3; Thioredoxin domain (PF13192; HMM-score: 15.3)
    Thioredoxin_9; Thioredoxin (PF14595; HMM-score: 14.8)
    Thioredoxin_4; Thioredoxin (PF13462; HMM-score: 14.2)
    DUF953; Eukaryotic protein of unknown function (DUF953) (PF06110; HMM-score: 13.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.142
    • Ymax_pos: 11
    • Cmax: 0.143
    • Cmax_pos: 35
    • Smax: 0.305
    • Smax_pos: 1
    • Smean: 0.172
    • D: 0.154
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 447113439 NCBI
  • RefSeq: WP_001190695 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MQSIKSNESFKSVINSDTPVIVKFEAGWCPDCRAMDLWIDPIVEQYNDYQWYTVNRDELEDVVVENEVMGIPSLLVFKNGDKIAHLHSANAKSPEQVESFLAETFK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS04375 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]