From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS04490 [old locus tag: NWMN_0793 ]
  • pan locus tag?: SAUPAN003019000
  • symbol: NWMN_RS04490
  • pan gene symbol?:
  • synonym:
  • product: DUF72 domain-containing protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS04490 [old locus tag: NWMN_0793 ]
  • symbol: NWMN_RS04490
  • product: DUF72 domain-containing protein
  • replicon: chromosome
  • strand: +
  • coordinates: 883289..884137
  • length: 849
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (883289..884137) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGATAAACATCGGATTAACAGGTTGGGGTGATCACTATTCATTATATGAAGATTTAGAA
    CGCCAAACCGATAAACTTAAAACATATGCTGGACATTTTCCGGTTGTCGAATTAGATGCG
    ACATACTATGCGATACAACCGGAAAGAAATATATTGAAATGGATAAAAGAAACGCCTGAT
    ACATTTGAATTTGTGGTCAAAATTCATCAAGCACTCACATTGCATGCAGACTACAAAACA
    TTTGCAGATACAAGGCAAGAACTATTTGATCAATTTAAGAATATGTTAGAGCCCTTACAT
    ACACAGAAAAAATTAGCAATGGTATTGGTTCAATTTCCGCCATGGTTTGACTGCAATGCA
    CAAAATATCAAATATATTTTGTATGTAAGACAGCAATTACAAGCATTTCCAATGTGTGTA
    GAATTTAGGCATCAATCATGGTTTAGTGATGCATTTAAAGAACAAACATTGGCATTTTTA
    ACAGAACATCAAATCATTCATGCAGTAGTTGATGAACCACAAGTGAAAGATGGCAGTGTA
    CCTTTAGTCAATCGAATCACAAATGAAATTGCGTTTGTACGTTATCATGGACGTAATCAT
    TACGGTTGGACTAAGAAAGATATGTCAGATCAAGAATGGCGCGATGTACGCTATTTATAT
    GATTATAATGAGCAAGAATTAATAGACTTGGCACAAAAGGCACAAATATTAGCACAAAAA
    GCTAAGAAAGTTTACGTCATATTTAACAATAATTCTGGTGGTCATGCAGCAAATAATGCC
    AAAACATATCAGCGATTATTGAATATAGAATATGAAGGGTTAGCACCACAACAATTAAAA
    TTATTTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    849

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS04490 [old locus tag: NWMN_0793 ]
  • symbol: NWMN_RS04490
  • description: DUF72 domain-containing protein
  • length: 282
  • theoretical pI: 6.74448
  • theoretical MW: 33316.7
  • GRAVY: -0.484397

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 17.2)
  • TheSEED:
  • PFAM:
    no clan definedDUF72; Protein of unknown function DUF72 (PF01904; HMM-score: 202.4)
    NADP_Rossmann (CL0063) NNMT_PNMT_TEMT; NNMT/PNMT/TEMT family (PF01234; HMM-score: 11.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.089
    • Ymax_pos: 70
    • Cmax: 0.106
    • Cmax_pos: 54
    • Smax: 0.099
    • Smax_pos: 23
    • Smean: 0.061
    • D: 0.078
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446530783 NCBI
  • RefSeq: WP_000608129 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MINIGLTGWGDHYSLYEDLERQTDKLKTYAGHFPVVELDATYYAIQPERNILKWIKETPDTFEFVVKIHQALTLHADYKTFADTRQELFDQFKNMLEPLHTQKKLAMVLVQFPPWFDCNAQNIKYILYVRQQLQAFPMCVEFRHQSWFSDAFKEQTLAFLTEHQIIHAVVDEPQVKDGSVPLVNRITNEIAFVRYHGRNHYGWTKKDMSDQEWRDVRYLYDYNEQELIDLAQKAQILAQKAKKVYVIFNNNSGGHAANNAKTYQRLLNIEYEGLAPQQLKLF

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS04490 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]