From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS05500 [old locus tag: NWMN_0982 ]
  • pan locus tag?: SAUPAN003344000
  • symbol: NWMN_RS05500
  • pan gene symbol?: ctaM
  • synonym:
  • product: membrane protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS05500 [old locus tag: NWMN_0982 ]
  • symbol: NWMN_RS05500
  • product: membrane protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1091398..1091859
  • length: 462
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (1091398..1091859) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGGGCGTTCCAATTTTACCAACGATTAGTACGACATGTATTGTCATTAGTGCAATTTTA
    ATTGCCATTGGTTGGAGACTTATTTGGAAAAGGGAAATAAATAAACACAAAAATGTTATG
    TTAGCTGCAGCTGTTTTTGCTTTAACTTTTTTCTTAATCTATGCAAGTAGAACGATTTTT
    ATCGGTAATACAGCATTTGGCGGACCAGCATCAATTAAGAAATATTATACGATTTTCTTA
    TTTTTCCACATTAATTTAGCAACAATTGGTGGTATTCTAGGCCTAGTTCAAATTATTACT
    GCATTTAAAGATAAATATAATGTACACCGCAAATTCGGGCCATTCGCTTCAGTTATATGG
    TTCTGTACTGCAATTACAGGTGTAGCAGTTTACTTATTATTATATGTATTATATCCAGGT
    GGAGAAACGACATCACTGATTAAAGCAACATTTGGTCATTAA
    60
    120
    180
    240
    300
    360
    420
    462

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS05500 [old locus tag: NWMN_0982 ]
  • symbol: NWMN_RS05500
  • description: membrane protein
  • length: 153
  • theoretical pI: 10.3728
  • theoretical MW: 16909.2
  • GRAVY: 0.870588

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    no clan definedDUF420; Protein of unknown function (DUF420) (PF04238; HMM-score: 126.5)
    DUF2306; Predicted membrane protein (DUF2306) (PF10067; HMM-score: 34.8)
    DUF3488; Domain of unknown function (DUF3488) (PF11992; HMM-score: 13.7)
    DUF4750; Domain of unknown function (DUF4750) (PF15938; HMM-score: 11.7)
    TMCCDC2; Transmembrane and coiled-coil domain-containing protein 2 (PF15844; HMM-score: 11.5)
    Tetraspannin (CL0347) Tetraspannin; Tetraspanin family (PF00335; HMM-score: 9.4)
    no clan definedDHHC; DHHC palmitoyltransferase (PF01529; HMM-score: 9.4)
    DUF4131; Domain of unknown function (DUF4131) (PF13567; HMM-score: 7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.176
    • Ymax_pos: 11
    • Cmax: 0.125
    • Cmax_pos: 32
    • Smax: 0.376
    • Smax_pos: 6
    • Smean: 0.317
    • D: 0.231
  • predicted transmembrane helices (TMHMM): 4

Accession numbers[edit source | edit]

  • GI: 446460912 NCBI
  • RefSeq: WP_000538766 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MGVPILPTISTTCIVISAILIAIGWRLIWKREINKHKNVMLAAAVFALTFFLIYASRTIFIGNTAFGGPASIKKYYTIFLFFHINLATIGGILGLVQIITAFKDKYNVHRKFGPFASVIWFCTAITGVAVYLLLYVLYPGGETTSLIKATFGH

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS05500 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]