From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS05560 [old locus tag: NWMN_0991 ]
  • pan locus tag?: SAUPAN003356000
  • symbol: NWMN_RS05560
  • pan gene symbol?: rpmF
  • synonym:
  • product: 50S ribosomal protein L32

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS05560 [old locus tag: NWMN_0991 ]
  • symbol: NWMN_RS05560
  • product: 50S ribosomal protein L32
  • replicon: chromosome
  • strand: +
  • coordinates: 1098608..1098781
  • length: 174
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (1098608..1098781) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    ATGGCAGTACCAAAAAGAAGAACTTCTAAAACTAGAAAAAACAAACGTCGTACGCATTTC
    AAAATTTCAGTACCAGGTATGACTGAATGCCCAAACTGTGGCGAATACAAATTATCACAC
    CGTGTATGTAAAAACTGTGGTTCTTACAATGGCGAAGAAGTAGCAGCTAAATAA
    60
    120
    174

Protein[edit source | edit]

Protein Data Bank: 5LI0
Protein Data Bank: 4WCE
Protein Data Bank: 4WFB
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 5HL7

General[edit source | edit]

  • locus tag: NWMN_RS05560 [old locus tag: NWMN_0991 ]
  • symbol: NWMN_RS05560
  • description: 50S ribosomal protein L32
  • length: 57
  • theoretical pI: 10.6639
  • theoretical MW: 6484.52
  • GRAVY: -1.0614

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein bL32 (TIGR01031; HMM-score: 97.1)
    Genetic information processingMobile and extrachromosomal element functionsProphage functionsphage/conjugal plasmid C-4 type zinc finger protein, TraR family (TIGR02419; HMM-score: 13.3)
    Signal transductionRegulatory functionsDNA interactionsputative regulatory protein, FmdB family (TIGR02605; HMM-score: 13.2)
    YgiT-type zinc finger domain (TIGR03831; HMM-score: 11.9)
  • TheSEED:
  • PFAM:
    Zn_Beta_Ribbon (CL0167) Ribosomal_L32p; Ribosomal L32p protein family (PF01783; HMM-score: 96.1)
    zf-ribbon_3; zinc-ribbon domain (PF13248; HMM-score: 20.5)
    DZR; Double zinc ribbon (PF12773; HMM-score: 19.1)
    zinc_ribbon_2; zinc-ribbon domain (PF13240; HMM-score: 17.4)
    no clan definedHypA; Hydrogenase/urease nickel incorporation, metallochaperone, hypA (PF01155; HMM-score: 17)
    Zn_Beta_Ribbon (CL0167) Zn-ribbon_8; Zinc ribbon domain (PF09723; HMM-score: 16)
    no clan definedzf-tcix; Putative treble-clef, zinc-finger, Zn-binding (PF14952; HMM-score: 14.5)
    Nop10p; Nucleolar RNA-binding protein, Nop10p family (PF04135; HMM-score: 14.3)
    PFL-like (CL0339) NRDD; Anaerobic ribonucleoside-triphosphate reductase (PF13597; HMM-score: 12.7)
    Zn_Beta_Ribbon (CL0167) TF_Zn_Ribbon; TFIIB zinc-binding (PF08271; HMM-score: 12.1)
    no clan definedPolC_DP2; DNA polymerase II large subunit DP2 (PF03833; HMM-score: 10.5)
    zinc_ribbon_6; Zinc-ribbon (PF14599; HMM-score: 10.4)
    Zn_Beta_Ribbon (CL0167) Prim_Zn_Ribbon; Zinc-binding domain of primase-helicase (PF08273; HMM-score: 7.3)
    DUF1610; Domain of unknown function (DUF1610) (PF07754; HMM-score: 6.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • LocateP:
  • SignalP: Signal peptide length 13 aa
    • Ymax: 0.275
    • Ymax_pos: 13
    • Cmax: 0.108
    • Cmax_pos: 42
    • Smax: 0.801
    • Smax_pos: 7
    • Smean: 0.752
    • D: 0.461
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446212617 NCBI
  • RefSeq: WP_000290472 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MAVPKRRTSKTRKNKRRTHFKISVPGMTECPNCGEYKLSHRVCKNCGSYNGEEVAAK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS05560 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]