From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS05580 [old locus tag: NWMN_0994 ]
  • pan locus tag?: SAUPAN001421000
  • symbol: NWMN_RS05580
  • pan gene symbol?:
  • synonym:
  • product: XRE family transcriptional regulator

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS05580 [old locus tag: NWMN_0994 ]
  • symbol: NWMN_RS05580
  • product: XRE family transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 1101519..1102238
  • length: 720
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (1101519..1102238) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGGATAAAAAAGAATTAGCGAAATTTATAGGCAATAAAATCAGATACTATAGAACCAAA
    TTGAACTTAACTCAAGATCAACTTGGAGAAAAACTCAACACTAAAAAGGCTACTATTTCA
    AATTATGAGACAGGGTACAGAACTCCTAAACAAGATGATTTGTTTGAAATTGCTCATATT
    TTAAATATCAGTATCGATGATTTGTTTCCTACAAGAAATAATAAAAAAAACGACATCACT
    TCCATATACAGTAAACTCACGCCTCCAAGACAAAAAAACGTACTTAACTACGCAAATGAG
    CAATTAGATGAACAGAATAAAGTCACTTCTATAGATGAATATAAAGAGTCTAAACTAGTA
    TCGTATATTGCATGTGGTGCAACTGGTGCTGGCATAGGAGAAGAATTATATGATGACATA
    TTGCATGAAGAAGTATTTTTTAAAGAAGACGAAACGCCATCAAATGCTGATTTTTGTATT
    TTAGTTAATGGTGATTCAATGGAACCTATGTTAAAACAAGGAACATACGCTTTTATTAAG
    AAAGAAGATTCTATTAAAGATGGTACAATTGCACTCGTTGTATTAGATGGAGTAAGTCTT
    ATCAAGCGTGTAGATATATGCGAAGACTATATTAATTTGGTATCTCTAAATCCGAAGTAT
    GATGATATCAAAGTCGCTTCGTTTAGTAATATTAAAGTAATGGGCAAAGTTGTATTGTGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS05580 [old locus tag: NWMN_0994 ]
  • symbol: NWMN_RS05580
  • description: XRE family transcriptional regulator
  • length: 239
  • theoretical pI: 4.92692
  • theoretical MW: 27127.7
  • GRAVY: -0.442259

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Signal transductionRegulatory functionsDNA interactionstranscriptional regulator, y4mF family (TIGR03070; HMM-score: 32.1)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairrepressor LexA (TIGR00498; EC 3.4.21.88; HMM-score: 29)
    Signal transductionRegulatory functionsDNA interactionsrepressor LexA (TIGR00498; EC 3.4.21.88; HMM-score: 29)
    putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 28.3)
    Hypothetical proteinsConservedTIGR00270 family protein (TIGR00270; HMM-score: 21.7)
    MetabolismEnergy metabolismBiosynthesis and degradation of polysaccharidesglucose-1-phosphate adenylyltransferase, GlgD subunit (TIGR02092; EC 2.7.7.27; HMM-score: 19.8)
    signal peptidase I (TIGR02228; EC 3.4.21.89; HMM-score: 15.9)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingsignal peptidase I (TIGR02227; EC 3.4.21.89; HMM-score: 13.5)
    Cellular processesCellular processesDetoxificationnickel-type superoxide dismutase maturation protease (TIGR02754; EC 3.4.21.-; HMM-score: 13.2)
    Genetic information processingProtein fateProtein modification and repairnickel-type superoxide dismutase maturation protease (TIGR02754; EC 3.4.21.-; HMM-score: 13.2)
  • TheSEED:
  • PFAM:
    HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 59.2)
    Peptidase_SF (CL0299) Peptidase_S24; Peptidase S24-like (PF00717; HMM-score: 41.5)
    HTH (CL0123) HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 40.7)
    HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 31.3)
    Pou; Pou domain - N-terminal to homeobox domain (PF00157; HMM-score: 16.1)
    HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 14.7)
    no clan definedBNIP2; Bcl2-/adenovirus E1B nineteen kDa-interacting protein 2 (PF12496; HMM-score: 13.4)
    HTH (CL0123) MqsA_antitoxin; Antitoxin component of bacterial toxin-antitoxin system, MqsA (PF15731; HMM-score: 12.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.123
    • Ymax_pos: 38
    • Cmax: 0.106
    • Cmax_pos: 37
    • Smax: 0.205
    • Smax_pos: 6
    • Smean: 0.118
    • D: 0.121
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446280369 NCBI
  • RefSeq: WP_000358224 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MDKKELAKFIGNKIRYYRTKLNLTQDQLGEKLNTKKATISNYETGYRTPKQDDLFEIAHILNISIDDLFPTRNNKKNDITSIYSKLTPPRQKNVLNYANEQLDEQNKVTSIDEYKESKLVSYIACGATGAGIGEELYDDILHEEVFFKEDETPSNADFCILVNGDSMEPMLKQGTYAFIKKEDSIKDGTIALVVLDGVSLIKRVDICEDYINLVSLNPKYDDIKVASFSNIKVMGKVVL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS05580 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]