From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS06595 [old locus tag: NWMN_1169 ]
  • pan locus tag?: SAUPAN003559000
  • symbol: NWMN_RS06595
  • pan gene symbol?: frr
  • synonym:
  • product: ribosome-recycling factor

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS06595 [old locus tag: NWMN_1169 ]
  • symbol: NWMN_RS06595
  • product: ribosome-recycling factor
  • replicon: chromosome
  • strand: +
  • coordinates: 1283485..1284039
  • length: 555
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (1283485..1284039) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAGTGACATTATTAATGAAACTAAATCAAGAATGCAAAAATCAATCGAAAGCTTATCA
    CGTGAATTAGCTAACATCAGTGCAGGAAGAGCTAATTCAAATTTATTAAACGGCGTAACA
    GTTGATTACTATGGTGCACCAACACCTGTACAACAATTAGCAAGCATCAATGTTCCAGAA
    GCACGTTTACTTGTTATTTCTCCATACGACAAAACTTCTGTAGCTGACATCGAAAAAGCG
    ATAATAGCAGCTAACTTAGGTGTTAACCCAACAAGTGATGGTGAAGTGATACGTATTGCT
    GTACCTGCCTTAACAGAAGAACGTAGAAAAGAGCGCGTTAAAGATGTTAAGAAAATTGGT
    GAAGAAGCTAAAGTATCTGTTCGAAATATTCGTCGTGATATGAATGATCAGTTGAAAAAA
    GATGAAAAAAATGGCGACATTACTGAAGATGAGTTGAGAAGTGGTACTGAAGATGTTCAG
    AAAGCAACAGACAATTCAATAAAAGAAATTGATCAAATGATTGCTGATAAAGAAAAAGAT
    ATTATGTCAGTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    555

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS06595 [old locus tag: NWMN_1169 ]
  • symbol: NWMN_RS06595
  • description: ribosome-recycling factor
  • length: 184
  • theoretical pI: 4.7658
  • theoretical MW: 20352.8
  • GRAVY: -0.584783

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein synthesisTranslation factorsribosome recycling factor (TIGR00496; HMM-score: 241.4)
    MetabolismEnergy metabolismATP-proton motive force interconversionV-type ATPase, G subunit (TIGR01147; EC 3.6.3.14; HMM-score: 16.8)
    Genetic information processingMobile and extrachromosomal element functionsProphage functionsphage tail tape measure protein, lambda family (TIGR01541; HMM-score: 11.9)
  • TheSEED:
  • PFAM:
    no clan definedRRF; Ribosome recycling factor (PF01765; HMM-score: 206.7)
    ATP_synthase (CL0255) V-ATPase_G; Vacuolar (H+)-ATPase G subunit (PF03179; HMM-score: 16.6)
    no clan definedRRF_GI; Ribosome recycling factor (PF12614; HMM-score: 16.4)
    Fib_alpha; Fibrinogen alpha/beta chain family (PF08702; HMM-score: 13.4)
    Ribosomal_S6; Ribosomal protein S6 (PF01250; HMM-score: 12.4)
    DUF5082; Domain of unknown function (DUF5082) (PF16888; HMM-score: 10.2)
    YjbJ-CsbD-like (CL0406) DUF883; Bacterial protein of unknown function (DUF883) (PF05957; HMM-score: 9.6)
    Transthyretin (CL0287) DUF2606; Protein of unknown function (DUF2606) (PF10794; HMM-score: 9.2)
    S5 (CL0329) Topo-VIb_trans; Topoisomerase VI B subunit, transducer (PF09239; HMM-score: 8.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.152
    • Ymax_pos: 30
    • Cmax: 0.122
    • Cmax_pos: 46
    • Smax: 0.32
    • Smax_pos: 26
    • Smean: 0.197
    • D: 0.17
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 447202750 NCBI
  • RefSeq: WP_001280006 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MSDIINETKSRMQKSIESLSRELANISAGRANSNLLNGVTVDYYGAPTPVQQLASINVPEARLLVISPYDKTSVADIEKAIIAANLGVNPTSDGEVIRIAVPALTEERRKERVKDVKKIGEEAKVSVRNIRRDMNDQLKKDEKNGDITEDELRSGTEDVQKATDNSIKEIDQMIADKEKDIMSV

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS06595 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]