From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS08200 [old locus tag: NWMN_1453 ]
  • pan locus tag?: SAUPAN004131000
  • symbol: NWMN_RS08200
  • pan gene symbol?:
  • synonym:
  • product: 5-formyltetrahydrofolate cyclo-ligase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS08200 [old locus tag: NWMN_1453 ]
  • symbol: NWMN_RS08200
  • product: 5-formyltetrahydrofolate cyclo-ligase
  • replicon: chromosome
  • strand: -
  • coordinates: 1620732..1621271
  • length: 540
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (1620732..1621271) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    GTGACTAAAAATGAGATTAGAAAATACATTTTACATAAAATGAAGAATTTTAATAAAGCT
    GAAAAGCGAAAAGCAGACACATGGTTAAGAAATCAATTTTTTGCAACTGAAGAATACAAA
    GAAGCAAACGCAATTGCGCTAGTTCTTTCTTTTAATCATGAAGTAGATACTTTTTCTATT
    ATTGAACAAGCCTTAATGGATCATAAACGTATTTTTGTACCGAAAATGGATTATTTAAAT
    CATCAAATGACTTTTAAAGAGATATTTAATCTCAAAGATATTGATGTCGATAATAAGGGG
    ATTTACTATCCAACTTCAAAAGGTGAAACAACGAATAACCTAGATTTAATTGTTGTTCCT
    GGTGTTGGATTTCAAGACGATGGATATAGAATTGGGTATGGTGGTGGCTATTACGACAGG
    TTTTTAGCTAATTATCAGACAAAGACAATAAGCTTATTATACGATTTTCAAATAACATCA
    TTTGAACCGGAATCATTCGATCAACCAGTCGATAAATTGATTATATATCAAGCAGCATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS08200 [old locus tag: NWMN_1453 ]
  • symbol: NWMN_RS08200
  • description: 5-formyltetrahydrofolate cyclo-ligase
  • length: 179
  • theoretical pI: 6.12385
  • theoretical MW: 20999.7
  • GRAVY: -0.479888

Function[edit source | edit]

  • reaction:
    EC 6.3.3.2?  ExPASy
    5-formyltetrahydrofolate cyclo-ligaseATP + 5-formyltetrahydrofolate = ADP + phosphate + 5,10-methenyltetrahydrofolate
  • TIGRFAM:
    MetabolismCentral intermediary metabolismOne-carbon metabolism5-formyltetrahydrofolate cyclo-ligase (TIGR02727; EC 6.3.3.2; HMM-score: 160.7)
  • TheSEED:
  • PFAM:
    ISOCOT_Fold (CL0246) 5-FTHF_cyc-lig; 5-formyltetrahydrofolate cyclo-ligase family (PF01812; HMM-score: 128.3)
    Rep (CL0169) PV_NSP1; Parvovirus non-structural protein 1 (PF12433; HMM-score: 16.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Mg2+
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.17
    • Ymax_pos: 11
    • Cmax: 0.156
    • Cmax_pos: 26
    • Smax: 0.4
    • Smax_pos: 2
    • Smean: 0.285
    • D: 0.215
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI:
  • RefSeq: WP_000164545 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MTKNEIRKYILHKMKNFNKAEKRKADTWLRNQFFATEEYKEANAIALVLSFNHEVDTFSIIEQALMDHKRIFVPKMDYLNHQMTFKEIFNLKDIDVDNKGIYYPTSKGETTNNLDLIVVPGVGFQDDGYRIGYGGGYYDRFLANYQTKTISLLYDFQITSFEPESFDQPVDKLIIYQAA

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS08200 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]