From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS08485 [old locus tag: NWMN_1508 ]
  • pan locus tag?: SAUPAN004203000
  • symbol: NWMN_RS08485
  • pan gene symbol?:
  • synonym:
  • product: acetyl-CoA carboxylase biotin carboxyl carrier protein subunit

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS08485 [old locus tag: NWMN_1508 ]
  • symbol: NWMN_RS08485
  • product: acetyl-CoA carboxylase biotin carboxyl carrier protein subunit
  • replicon: chromosome
  • strand: -
  • coordinates: 1674213..1674662
  • length: 450
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (1674213..1674662) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAATATTGAAAAAATCGAACAAATAATCAAATTAGTGAAGGAAAATGATGTTAAGAAA
    TTTAAATATAAAAATTTTGAAGATGAAATAGAAATTGACTTCACTGACTCGAATCATTTG
    GCTGCACACAGTAATCAATCAAATCAAAGTATGAACAATAATGATTTGACAGCTTCAAAA
    GCGAATGATAACTCCGATGTTTCGACAAATGATTATCATGACATTAAATCACCAATGATA
    GGTACATTCTTTTTACAAGATAGTAAAGAATTAACTGAACCAATTGTGAATGTCGGTGAC
    AAAGTTAACAAGGGAGATATTATAGGATATGTTGAAGCGATGAAAGTATTAAACGAGGTA
    ACAACAGATGTTGCTGGAGAAATTACTGAAATAGTAGCTGATCATGGCACAAATGTTGAA
    TACGACCAAGTTTTGGTACGTATTAAGTAA
    60
    120
    180
    240
    300
    360
    420
    450

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS08485 [old locus tag: NWMN_1508 ]
  • symbol: NWMN_RS08485
  • description: acetyl-CoA carboxylase biotin carboxyl carrier protein subunit
  • length: 149
  • theoretical pI: 4.33078
  • theoretical MW: 16793.5
  • GRAVY: -0.571141

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismFatty acid and phospholipid metabolismBiosynthesisacetyl-CoA carboxylase, biotin carboxyl carrier protein (TIGR00531; HMM-score: 109.4)
    MetabolismCentral intermediary metabolismNitrogen metabolismurea carboxylase (TIGR02712; EC 6.3.4.6; HMM-score: 35.4)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsoxaloacetate decarboxylase alpha subunit (TIGR01108; EC 4.1.1.3; HMM-score: 34)
    MetabolismEnergy metabolismOtheroxaloacetate decarboxylase alpha subunit (TIGR01108; EC 4.1.1.3; HMM-score: 34)
    MetabolismEnergy metabolismPyruvate dehydrogenasedihydrolipoyllysine-residue acetyltransferase (TIGR01348; EC 2.3.1.12; HMM-score: 25.6)
    MetabolismEnergy metabolismGlycolysis/gluconeogenesispyruvate carboxylase (TIGR01235; EC 6.4.1.1; HMM-score: 24.9)
    MetabolismEnergy metabolismTCA cycledihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex (TIGR01347; EC 2.3.1.61; HMM-score: 23.7)
    2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (TIGR02927; EC 2.3.1.61; HMM-score: 19)
    MetabolismEnergy metabolismATP-proton motive force interconversionATP synthase archaeal, A subunit (TIGR01043; EC 3.6.3.14; HMM-score: 17.3)
    selenium-dependent molybdenum hydroxylase system protein, YqeB family (TIGR03309; HMM-score: 16.8)
    MetabolismEnergy metabolismElectron transportelectron transport complex, RnfABCDGE type, C subunit (TIGR01945; HMM-score: 15.9)
    MetabolismEnergy metabolismAmino acids and aminesglycine cleavage system H protein (TIGR00527; HMM-score: 15.5)
    proline reductase-associated electron transfer protein PrdC (TIGR04481; HMM-score: 14.2)
    MetabolismTransport and binding proteinsUnknown substrateefflux transporter, RND family, MFP subunit (TIGR01730; HMM-score: 12.5)
    MetabolismEnergy metabolismPyruvate dehydrogenasepyruvate dehydrogenase complex dihydrolipoamide acetyltransferase (TIGR01349; EC 2.3.1.12; HMM-score: 9.2)
  • TheSEED:
  • PFAM:
    Hybrid (CL0105) Biotin_lipoyl; Biotin-requiring enzyme (PF00364; HMM-score: 67.3)
    RnfC_N; RnfC Barrel sandwich hybrid domain (PF13375; HMM-score: 25.4)
    GCV_H; Glycine cleavage H-protein (PF01597; HMM-score: 21.1)
    Biotin_lipoyl_2; Biotin-lipoyl like (PF13533; HMM-score: 19)
    no clan definedATP-synt_ab_Xtn; ATPsynthase alpha/beta subunit N-term extension (PF16886; HMM-score: 18.4)
    BET; Bromodomain extra-terminal - transcription regulation (PF17035; HMM-score: 14.4)
    Hybrid (CL0105) Peptidase_M23; Peptidase family M23 (PF01551; HMM-score: 13.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.13
    • Ymax_pos: 62
    • Cmax: 0.114
    • Cmax_pos: 59
    • Smax: 0.194
    • Smax_pos: 10
    • Smean: 0.122
    • D: 0.127
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446942081 NCBI
  • RefSeq: WP_001019337 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MNIEKIEQIIKLVKENDVKKFKYKNFEDEIEIDFTDSNHLAAHSNQSNQSMNNNDLTASKANDNSDVSTNDYHDIKSPMIGTFFLQDSKELTEPIVNVGDKVNKGDIIGYVEAMKVLNEVTTDVAGEITEIVADHGTNVEYDQVLVRIK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS08485 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]