From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS09135 [old locus tag: NWMN_1627 ]
  • pan locus tag?: SAUPAN004398000
  • symbol: NWMN_RS09135
  • pan gene symbol?: acuA
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS09135 [old locus tag: NWMN_1627 ]
  • symbol: NWMN_RS09135
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1811222..1811854
  • length: 633
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (1811222..1811854) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAATCATTTAAAGACGTATCAATCCGAAGATTATTACATTCATGACAAGCAATTTGTT
    ATTGAAGGTCCTTTAACACACGAAGATTTGAAAGCGCTTACTTTCGATGCGCATTTAACC
    GCATTTAGAGATGCTGAAGATCAGTATAAAGCTTTGTTAGAAATTACAACATTACCAGAA
    GGTAGAATTTATGTTGCTCGCCAAGATCAACTCATTGTGGGTTATGTCACTTTCCACTAT
    CCTGATGAAATTGAGCGCTGGTCTACAGGTAAGCTTCCATATTTAATCGAATTGGGGGCA
    ATTGAAGTCAGCATCAATTTTAGGCAATTACAACTTGCAGAAAAGCTGATACAACTTAGC
    CTTTCTACACCAGAATTCGAGAATTATATCGTTATAACTACAGAATATTACTGGCATTGG
    GATTTAAAAAATTCAAAGTTAGATGTATTTGACTATAAAAAATTAATGCAGCGGTTAATG
    GCAACTGGTGGACTTGAAATATTCGCTACAGATGATCCAGAAATAACAAGTCATCCAGCT
    AATTGTTTAATGGCAAGAATTGGCAAAAACATTACATTAGAACAGCAACAAGCGTTTGAT
    GATATTCGTTATATGAATCGGTTTTTCTTTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    633

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS09135 [old locus tag: NWMN_1627 ]
  • symbol: NWMN_RS09135
  • description: hypothetical protein
  • length: 210
  • theoretical pI: 4.741
  • theoretical MW: 24776
  • GRAVY: -0.325238

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    Acetyltrans (CL0257) Acetyltransf_7; Acetyltransferase (GNAT) domain (PF13508; HMM-score: 13)
    Acetyltransf_1; Acetyltransferase (GNAT) family (PF00583; HMM-score: 12.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.093
    • Ymax_pos: 70
    • Cmax: 0.113
    • Cmax_pos: 33
    • Smax: 0.113
    • Smax_pos: 67
    • Smean: 0.068
    • D: 0.083
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446938740 NCBI
  • RefSeq: WP_001015996 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MNHLKTYQSEDYYIHDKQFVIEGPLTHEDLKALTFDAHLTAFRDAEDQYKALLEITTLPEGRIYVARQDQLIVGYVTFHYPDEIERWSTGKLPYLIELGAIEVSINFRQLQLAEKLIQLSLSTPEFENYIVITTEYYWHWDLKNSKLDVFDYKKLMQRLMATGGLEIFATDDPEITSHPANCLMARIGKNITLEQQQAFDDIRYMNRFFF

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS09135 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]