From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS09250 [old locus tag: NWMN_1648 ]
  • pan locus tag?: SAUPAN004433000
  • symbol: NWMN_RS09250
  • pan gene symbol?:
  • synonym:
  • product: aminoacetone oxidase family FAD-binding enzyme

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS09250 [old locus tag: NWMN_1648 ]
  • symbol: NWMN_RS09250
  • product: aminoacetone oxidase family FAD-binding enzyme
  • replicon: chromosome
  • strand: +
  • coordinates: 1837053..1838321
  • length: 1269
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (1837053..1838321) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    1261
    ATGTATCAAACAATTATTATCGGAGGCGGACCTAGCGGCTTAATGGCGGCAGTAGCTGCA
    AGCGAACAAAGTAGCAGTGTGTTACTCATTGAAAAAAAGAAAGGTCTAGGTCGTAAACTC
    AAAATATCTGGTGGCGGTAGATGTAACGTAACTAATCGATTACCATATGCTGAAATTATT
    AAGAACATTCCTGGAAATGGGAAATTTTTATATAGTCCCTTTTCAATTTTTGATAATGAA
    TCCATCATAGATTTTTTTGAGTCTAGGGGTGTTAAATTAAAAGAAGAAGATCACGGGCGT
    ATGTTTCCAGTTTCCAACAAAGCACAAGACGTGGTTGATACATTAGTGACAACTATCGAA
    CGCCAACATGTAACGATTAAAGAAGAAGAAGCTGTTAGTAGAATCGAAGTTAATACAGAC
    CAAACTTTCACTGTACATACTCAAAATAATAGTTATGAAAGCCATTCGCTAGTGATTGCT
    ACAGGTGGTACAAGTGTCCCTCAAACTGGTTCAACTGGTGATGGTTATAAGTTCGCACAA
    GATTTAGGTCATACCATTACTGAGTTATTCCCGACCGAAGTTCCAATTACATCAGCTGAA
    CCTTTCATCAAATCCAATCGTCTAAAAGGTTTAAGTTTAAAAGATGTTGAATTGTCAGTA
    CTTAAGAAAAATGGTAAAAAACGCATCAGTCATCAAATGGATATGTTATTTACTCATTTT
    GGTATCAGTGGTCCAGCTGCATTAAGATGTAGTCAGTTTGTTTATAAAGAACAAAAAAAT
    CAAAAGACACAGCACATTTCTATGGCAATCGATGCATTTCCTGAATTAAACCATGAACAA
    TTAAAACAACACATCACATCATTATTATCGGACACACCAGATAAAATCATTAAAAACAGT
    TTGCATGGTCTAATTGAAGAGCGCTACTTACTGTTCATGCTGGAACAAGCAGGAATCGAT
    GAAAATACCACATCACATCACTTATCAAATCAACAATTGAACGACTTAGTAAATATGTTT
    AAAGGGTTTGTATTTAAGGTGAACGGGACATTACCTATAGATAAGGCATTTGTCACAGGT
    GGTGGTGTGTCACTTAAAGAAATTCAACCTAAAACAATGATGTCTAAATTAGTTCCGGGA
    TTATTTTTATGTGGTGAAGTATTAGATATACATGGTTATACTGGTGGTTATAATATTACA
    AGTGCACTCGTAACAGGACATGTCGCTGGATTATATGCCGGACATTACTCACATGCATCA
    ATGGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1260
    1269

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS09250 [old locus tag: NWMN_1648 ]
  • symbol: NWMN_RS09250
  • description: aminoacetone oxidase family FAD-binding enzyme
  • length: 422
  • theoretical pI: 7.3187
  • theoretical MW: 46415.7
  • GRAVY: -0.228199

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Unknown functionEnzymes of unknown specificityflavoprotein, HI0933 family (TIGR00275; HMM-score: 478.6)
    flavoprotein, TIGR03862 family (TIGR03862; HMM-score: 130.4)
    Unknown functionEnzymes of unknown specificityputative bacillithiol system oxidoreductase, YpdA family (TIGR04018; EC 1.8.-.-; HMM-score: 38.8)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersChlorophyll and bacteriochlorphyllgeranylgeranyl reductase family (TIGR02032; EC 1.3.1.-; HMM-score: 35.5)
    MetabolismEnergy metabolismElectron transportthioredoxin-disulfide reductase (TIGR01292; EC 1.8.1.9; HMM-score: 34.6)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminprecorrin 3B synthase CobZ (TIGR02485; HMM-score: 33.9)
    dihydrolipoyl dehydrogenase (TIGR01350; EC 1.8.1.4; HMM-score: 32.3)
    putative alkyl hydroperoxide reductase F subunit (TIGR03143; EC 1.6.4.-; HMM-score: 24.6)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersPyridine nucleotidesL-aspartate oxidase (TIGR00551; EC 1.4.3.16; HMM-score: 23.5)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersThiamineglycine oxidase ThiO (TIGR02352; EC 1.4.3.19; HMM-score: 22.4)
    squalene-associated FAD-dependent desaturase (TIGR03467; HMM-score: 22.4)
    mycofactocin system FadH/OYE family oxidoreductase 2 (TIGR03997; EC 1.-.-.-; HMM-score: 22.4)
    flavin-dependent oxidoreductase, MSMEG_0569 family (TIGR04046; HMM-score: 21.9)
    Cellular processesCellular processesDetoxificationmercury(II) reductase (TIGR02053; EC 1.16.1.1; HMM-score: 20.2)
    Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain (TIGR03197; HMM-score: 20)
    MetabolismEnergy metabolismTCA cyclesuccinate dehydrogenase or fumarate reductase, flavoprotein subunit (TIGR01812; HMM-score: 19.4)
    MetabolismEnergy metabolismAnaerobicsuccinate dehydrogenase or fumarate reductase, flavoprotein subunit (TIGR01812; HMM-score: 19.4)
    MetabolismEnergy metabolismAerobicsuccinate dehydrogenase or fumarate reductase, flavoprotein subunit (TIGR01812; HMM-score: 19.4)
    MetabolismEnergy metabolismAmino acids and aminessarcosine oxidase, alpha subunit family (TIGR01372; HMM-score: 18.5)
    MetabolismEnergy metabolismElectron transportglutathione-disulfide reductase (TIGR01421; EC 1.8.1.7; HMM-score: 18.4)
    MetabolismEnergy metabolismElectron transportflavocytochrome c (TIGR01813; HMM-score: 18.1)
    MetabolismEnergy metabolismAmino acids and aminessarcosine oxidase, monomeric form (TIGR01377; HMM-score: 17.7)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMenaquinone and ubiquinone2-polyprenyl-6-methoxyphenol 4-hydroxylase (TIGR01984; EC 1.14.13.-; HMM-score: 15)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMenaquinone and ubiquinoneubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family (TIGR01988; EC 1.14.13.-; HMM-score: 14.7)
    Cellular processesCellular processesDetoxificationalkyl hydroperoxide reductase subunit F (TIGR03140; EC 1.8.1.-; HMM-score: 14.6)
    Cellular processesCellular processesAdaptations to atypical conditionsalkyl hydroperoxide reductase subunit F (TIGR03140; EC 1.8.1.-; HMM-score: 14.6)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersThiaminethiazole biosynthesis enzyme (TIGR00292; HMM-score: 14.4)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersChlorophyll and bacteriochlorphyllgeranylgeranyl reductase (TIGR02023; EC 1.3.1.-; HMM-score: 14)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesUDP-galactopyranose mutase (TIGR00031; EC 5.4.99.9; HMM-score: 13.6)
    thioredoxin and glutathione reductase (TIGR01438; EC 1.6.4.-; HMM-score: 13.6)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtherC-3',4' desaturase CrtD (TIGR02733; EC 1.3.99.-; HMM-score: 13.4)
    MetabolismEnergy metabolismAnaerobicglycerol-3-phosphate dehydrogenase, anaerobic, B subunit (TIGR03378; EC 1.1.5.3; HMM-score: 12.1)
    mycofactocin system FadH/OYE family oxidoreductase 1 (TIGR03996; EC 1.-.-.-; HMM-score: 11.2)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtherphytoene desaturase (TIGR02734; EC 1.14.99.-; HMM-score: 11)
    Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA (TIGR00136; HMM-score: 10.6)
    Unknown functionEnzymes of unknown specificityGMC family mycofactocin-associated oxidreductase (TIGR04542; EC 1.-.-.-; HMM-score: 9.7)
    lycopene cyclase family protein (TIGR01790; HMM-score: 8.8)
  • TheSEED:
  • PFAM:
    NADP_Rossmann (CL0063) HI0933_like; HI0933-like protein (PF03486; HMM-score: 519.3)
    Pyr_redox_3; Pyridine nucleotide-disulphide oxidoreductase (PF13738; HMM-score: 51.1)
    Pyr_redox_2; Pyridine nucleotide-disulphide oxidoreductase (PF07992; HMM-score: 36.6)
    FAD_binding_2; FAD binding domain (PF00890; HMM-score: 34.6)
    DAO; FAD dependent oxidoreductase (PF01266; HMM-score: 29.7)
    GIDA; Glucose inhibited division protein A (PF01134; HMM-score: 28.1)
    FAD_oxidored; FAD dependent oxidoreductase (PF12831; HMM-score: 27.3)
    NAD_binding_8; NAD(P)-binding Rossmann-like domain (PF13450; HMM-score: 23)
    NAD_binding_9; FAD-NAD(P)-binding (PF13454; HMM-score: 22.3)
    Pyr_redox; Pyridine nucleotide-disulphide oxidoreductase (PF00070; HMM-score: 20.5)
    FAD_binding_3; FAD binding domain (PF01494; HMM-score: 16.5)
    Trp_halogenase; Tryptophan halogenase (PF04820; HMM-score: 13.6)
    Thi4; Thi4 family (PF01946; HMM-score: 13.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.242
    • Ymax_pos: 20
    • Cmax: 0.234
    • Cmax_pos: 20
    • Smax: 0.356
    • Smax_pos: 16
    • Smean: 0.256
    • D: 0.248
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446207164 NCBI
  • RefSeq: WP_000285019 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MYQTIIIGGGPSGLMAAVAASEQSSSVLLIEKKKGLGRKLKISGGGRCNVTNRLPYAEIIKNIPGNGKFLYSPFSIFDNESIIDFFESRGVKLKEEDHGRMFPVSNKAQDVVDTLVTTIERQHVTIKEEEAVSRIEVNTDQTFTVHTQNNSYESHSLVIATGGTSVPQTGSTGDGYKFAQDLGHTITELFPTEVPITSAEPFIKSNRLKGLSLKDVELSVLKKNGKKRISHQMDMLFTHFGISGPAALRCSQFVYKEQKNQKTQHISMAIDAFPELNHEQLKQHITSLLSDTPDKIIKNSLHGLIEERYLLFMLEQAGIDENTTSHHLSNQQLNDLVNMFKGFVFKVNGTLPIDKAFVTGGGVSLKEIQPKTMMSKLVPGLFLCGEVLDIHGYTGGYNITSALVTGHVAGLYAGHYSHASME

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS09250 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]