From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS09400 [old locus tag: NWMN_1675 ]
  • pan locus tag?: SAUPAN004483000
  • symbol: NWMN_RS09400
  • pan gene symbol?: crcB2
  • synonym:
  • product: camphor resistance protein CrcB

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS09400 [old locus tag: NWMN_1675 ]
  • symbol: NWMN_RS09400
  • product: camphor resistance protein CrcB
  • replicon: chromosome
  • strand: +
  • coordinates: 1869894..1870247
  • length: 354
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (1869894..1870247) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGATATCAATCATTTTAGTCATGATTGGCGGCGGTTTTGGCGCAATTGCTAGAAGTGCC
    ATTACTGATTATTTTAATCATAAATTTACTTCAAAGTTACCTATCGCAACATTGATAGTA
    AATCTAGTTGGTAGTTTTTTAATTGGATTAACTATAGGCTTATCAATTTCAATCTCATGG
    TTCCCTGCGTTCTTTGTTACCGGTTTTTTAGGTGGCTTAACAACTTTCTCAACGTTAGCC
    AAAGAACTTACACTAATGATGACGCCAAAATTTAATATTAACCTTTTTCTCAATTATTCA
    CTTTTACAATTCATCATTGGATTTATAGCTTGTTATATTGGCTATCATATTTAA
    60
    120
    180
    240
    300
    354

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS09400 [old locus tag: NWMN_1675 ]
  • symbol: NWMN_RS09400
  • description: camphor resistance protein CrcB
  • length: 117
  • theoretical pI: 9.58674
  • theoretical MW: 12796.3
  • GRAVY: 1.13932

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Unknown functionGeneralprotein CrcB (TIGR00494; HMM-score: 67.7)
  • TheSEED:
  • PFAM:
    DMT (CL0184) CRCB; CrcB-like protein, Camphor Resistance (CrcB) (PF02537; HMM-score: 75.2)
    no clan definedMlaE; Permease MlaE (PF02405; HMM-score: 9)
    BPD_transp_1 (CL0404) FtsX; FtsX-like permease family (PF02687; HMM-score: 7.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.184
    • Ymax_pos: 18
    • Cmax: 0.161
    • Cmax_pos: 18
    • Smax: 0.29
    • Smax_pos: 14
    • Smean: 0.211
    • D: 0.194
  • predicted transmembrane helices (TMHMM): 4

Accession numbers[edit source | edit]

  • GI: 446546125 NCBI
  • RefSeq: WP_000623471 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MISIILVMIGGGFGAIARSAITDYFNHKFTSKLPIATLIVNLVGSFLIGLTIGLSISISWFPAFFVTGFLGGLTTFSTLAKELTLMMTPKFNINLFLNYSLLQFIIGFIACYIGYHI

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS09400 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]