From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS09790 [old locus tag: NWMN_1737 ]
  • pan locus tag?: SAUPAN004776000
  • symbol: NWMN_RS09790
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS09790 [old locus tag: NWMN_1737 ]
  • symbol: NWMN_RS09790
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1939013..1939357
  • length: 345
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (1939013..1939357) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGGCAGTAAATTTATATGATTATGCAAATCAATTAGAACAAGCTTTAAGAGAAAGCGAA
    GAATACAAAGCAATCAAAGAAGCATTCGCTAATGTAAAAGCTAACGAAGAATCTAAAAAG
    TTATTCGACGAGTTCCGTGAAACTCAAATTAACTTCCAACAAAAACAAATGCAAGGTGAA
    GAAATTGCTGAAGAAGATTTACAAAAAGCGCAAGAACAAGCGCAAGCAATTGAAAAAGAT
    GAAAACATCTCTGCATTAATGAATGCTGAACAAAAAATGAGTCAAGTATTCCAAGAAATC
    AACCAAATTATCGTTAAACCATTAGACGAAATTTACGCTGACTAA
    60
    120
    180
    240
    300
    345

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS09790 [old locus tag: NWMN_1737 ]
  • symbol: NWMN_RS09790
  • description: hypothetical protein
  • length: 114
  • theoretical pI: 4.03601
  • theoretical MW: 13309.7
  • GRAVY: -0.845614

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsCations and iron carrying compoundsferrous iron transport protein B (TIGR00437; HMM-score: 5.7)
  • TheSEED:
  • PFAM:
    no clan definedCom_YlbF; Control of competence regulator ComK, YlbF/YmcA (PF06133; HMM-score: 90.4)
    OFCC1; Orofacial cleft 1 candidate gene 1 protein (PF15680; HMM-score: 14.9)
    OmpH; Outer membrane protein (OmpH-like) (PF03938; HMM-score: 13.9)
    CompInhib_SCIN; Staphylococcal complement inhibitor SCIN (PF11546; HMM-score: 12)
    DUF3347; Protein of unknown function (DUF3347) (PF11827; HMM-score: 11.4)
    FRB_dom; FKBP12-rapamycin binding domain (PF08771; HMM-score: 11)
    DUF5362; Family of unknown function (DUF5362) (PF17319; HMM-score: 10.3)
    AD; Anticodon-binding domain (PF09793; HMM-score: 8.9)
    TMPIT; TMPIT-like protein (PF07851; HMM-score: 8.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.117
    • Ymax_pos: 25
    • Cmax: 0.109
    • Cmax_pos: 18
    • Smax: 0.181
    • Smax_pos: 17
    • Smean: 0.106
    • D: 0.113
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446212446 NCBI
  • RefSeq: WP_000290301 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MAVNLYDYANQLEQALRESEEYKAIKEAFANVKANEESKKLFDEFRETQINFQQKQMQGEEIAEEDLQKAQEQAQAIEKDENISALMNAEQKMSQVFQEINQIIVKPLDEIYAD

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS09790 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]