From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS10630 [old locus tag: NWMN_1850 ]
  • pan locus tag?: SAUPAN004945000
  • symbol: NWMN_RS10630
  • pan gene symbol?: nadE
  • synonym:
  • product: NAD(+) synthetase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS10630 [old locus tag: NWMN_1850 ]
  • symbol: NWMN_RS10630
  • product: NAD(+) synthetase
  • replicon: chromosome
  • strand: -
  • coordinates: 2061485..2062306
  • length: 822
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (2061485..2062306) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGAGTAAATTACAAGACGTTATTGTACAAGAAATGAAAGTGAAAAAGCGTATCGATAGT
    GCTGAAGAAATTATGGAATTAAAGCAATTTATAAAAAATTATGTACAATCACATTCATTT
    ATAAAATCTTTAGTGTTAGGTATTTCAGGAGGACAGGATTCTACATTAGTTGGAAAACTA
    GTACAAATGTCTGTTAACGAATTACGTGAAGAAGGCATTGATTGTACGTTTATTGCAGTT
    AAATTACCTTATGGAGTTCAAAAAGATGCTGATGAAGTTGAGCAAGCTTTGCGATTCATT
    GAACCAGATGAAATAGTAACAGTCAATATTAAGCCTGCAGTTGATCAAAGTGTGCAATCA
    TTAAAAGAAGCCGGTATTGTTCTTACAGATTTCCAAAAAGGAAATGAAAAAGCGCGTGAA
    CGTATGAAAGTACAATTTTCAATTGCTTCAAACCGACAAGGTATTGTAGTAGGAACAGAT
    CATTCAGCTGAAAATATAACTGGGTTTTATACGAAGTACGGTGATGGTGCTGCAGATATC
    GCACCTATATTTGGTTTGAATAAACGACAAGGTCGTCAATTATTAGCGTATCTTGGTGCG
    CCAAAGGAATTATATGAAAAAACGCCAACTGCTGATTTAGAAGATGATAAACCACAGCTT
    CCAGATGAAGATGCATTAGGTGTAACTTATGAGGCGATTGATAATTATTTAGAAGGTAAG
    CCAGTTACGCCAGAAGAACAAAAAGTAATTGAAAATCATTATATACGAAATGCACACAAA
    CGTGAACTTGCATATACAAGATACACGTGGCCAAAATCCTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    822

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS10630 [old locus tag: NWMN_1850 ]
  • symbol: NWMN_RS10630
  • description: NAD(+) synthetase
  • length: 273
  • theoretical pI: 5.00393
  • theoretical MW: 30696.6
  • GRAVY: -0.477656

Function[edit source | edit]

  • reaction:
    EC 6.3.1.5?  ExPASy
    NAD+ synthaseATP + deamido-NAD+ + NH3 = AMP + diphosphate + NAD+
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersPyridine nucleotidesNAD+ synthetase (TIGR00552; EC 6.3.1.5; HMM-score: 233.6)
    Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA(Ile)-lysidine synthetase (TIGR02432; EC 6.3.4.-; HMM-score: 15.2)
    Unknown functionGeneralqueuosine biosynthesis protein QueC (TIGR00364; HMM-score: 11.9)
    Genetic information processingDNA metabolismRestriction/modificationputative sulfurtransferase DndC (TIGR03183; HMM-score: 11.4)
  • TheSEED:
  • PFAM:
    HUP (CL0039) NAD_synthase; NAD synthase (PF02540; HMM-score: 226.6)
    ATP_bind_3; PP-loop family (PF01171; HMM-score: 14)
    no clan definedDUF3576; Domain of unknown function (DUF3576) (PF12100; HMM-score: 13.2)
    Nucleoporin_C; Non-repetitive/WGA-negative nucleoporin C-terminal (PF03177; HMM-score: 9.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.145
    • Ymax_pos: 52
    • Cmax: 0.14
    • Cmax_pos: 52
    • Smax: 0.21
    • Smax_pos: 51
    • Smean: 0.106
    • D: 0.13
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 445963018 NCBI
  • RefSeq: WP_000040873 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MSKLQDVIVQEMKVKKRIDSAEEIMELKQFIKNYVQSHSFIKSLVLGISGGQDSTLVGKLVQMSVNELREEGIDCTFIAVKLPYGVQKDADEVEQALRFIEPDEIVTVNIKPAVDQSVQSLKEAGIVLTDFQKGNEKARERMKVQFSIASNRQGIVVGTDHSAENITGFYTKYGDGAADIAPIFGLNKRQGRQLLAYLGAPKELYEKTPTADLEDDKPQLPDEDALGVTYEAIDNYLEGKPVTPEEQKVIENHYIRNAHKRELAYTRYTWPKS

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS10630 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]