From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS10745 [old locus tag: NWMN_1870 ]
  • pan locus tag?: SAUPAN005000000
  • symbol: NWMN_RS10745
  • pan gene symbol?:
  • synonym:
  • product: GntR family transcriptional regulator

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS10745 [old locus tag: NWMN_1870 ]
  • symbol: NWMN_RS10745
  • product: GntR family transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 2082635..2083015
  • length: 381
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (2082635..2083015) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAAAATAATTTTAAAAAACAATAGTGATTTTCCGATTTATGAACAGATTAAGCAACAA
    GTAAAACAAAATATTTTAAAGGGACATGTTGCTCCTGGAGAGCATTTGCCGTCAATGAGA
    GAACTTGCCAAAGATCTTCAAGTAAGTTTGATTACTACCAAACGTGCTTATGAAGATTTA
    GAGAAAGACGGTTTTGTTACAACAATTAGAGGAAAAGGGACCTTTGTTAAGGAGCAAGAT
    AGTTCTATTTTAAAAGAGAAACAATTTTTTACCATTGAAAATTTGGTTAAAGAATTGGTT
    AATGAAGCGCAAGCCATCGAAATGTCACTTGAGGAACTGCAGGATATTTTAACGTTCATT
    TATGAGGAGGAATCATCATGA
    60
    120
    180
    240
    300
    360
    381

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS10745 [old locus tag: NWMN_1870 ]
  • symbol: NWMN_RS10745
  • description: GntR family transcriptional regulator
  • length: 126
  • theoretical pI: 4.70971
  • theoretical MW: 14532.5
  • GRAVY: -0.430952

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismEnergy metabolismAmino acids and amineshistidine utilization repressor (TIGR02018; HMM-score: 59.3)
    Signal transductionRegulatory functionsDNA interactionshistidine utilization repressor (TIGR02018; HMM-score: 59.3)
    MetabolismTransport and binding proteinsAnionsphosphonate metabolism transcriptional regulator PhnF (TIGR02325; HMM-score: 45.2)
    Signal transductionRegulatory functionsDNA interactionsphosphonate metabolism transcriptional regulator PhnF (TIGR02325; HMM-score: 45.2)
    Signal transductionRegulatory functionsDNA interactionstrehalose operon repressor (TIGR02404; HMM-score: 43.6)
    Signal transductionRegulatory functionsDNA interactionsphosphonate utilization transcriptional regulator PhnR (TIGR03337; HMM-score: 35.1)
    phosphonate utilization associated transcriptional regulator (TIGR03338; HMM-score: 32.7)
    Signal transductionRegulatory functionsDNA interactionsCRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 23.8)
    MetabolismFatty acid and phospholipid metabolismBiosynthesisfatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 23.1)
    MetabolismFatty acid and phospholipid metabolismDegradationfatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 23.1)
    Signal transductionRegulatory functionsDNA interactionsfatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 23.1)
    Unknown functionGeneralRrf2 family protein (TIGR00738; HMM-score: 13.5)
    putative choline sulfate-utilization transcription factor (TIGR03418; HMM-score: 13.5)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtheriron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 13)
    Signal transductionRegulatory functionsDNA interactionsiron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 13)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairrepressor LexA (TIGR00498; EC 3.4.21.88; HMM-score: 12.8)
    Signal transductionRegulatory functionsDNA interactionsrepressor LexA (TIGR00498; EC 3.4.21.88; HMM-score: 12.8)
  • TheSEED:
  • PFAM:
    HTH (CL0123) GntR; Bacterial regulatory proteins, gntR family (PF00392; HMM-score: 64.4)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 19.3)
    Rrf2; Transcriptional regulator (PF02082; HMM-score: 19.2)
    HTH_41; Helix-turn-helix domain (PF14502; HMM-score: 18.3)
    no clan definedSyntaxin-6_N; Syntaxin 6, N-terminal (PF09177; HMM-score: 13.7)
    HTH (CL0123) RPA_C; Replication protein A C terminal (PF08784; HMM-score: 13.1)
    MarR_2; MarR family (PF12802; HMM-score: 13)
    MarR; MarR family (PF01047; HMM-score: 12.9)
    LexA_DNA_bind; LexA DNA binding domain (PF01726; HMM-score: 12.8)
    HTH_11; HTH domain (PF08279; HMM-score: 12.2)
    HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 12.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.116
    • Ymax_pos: 25
    • Cmax: 0.112
    • Cmax_pos: 44
    • Smax: 0.17
    • Smax_pos: 7
    • Smean: 0.121
    • D: 0.118
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446614238 NCBI
  • RefSeq: WP_000691584 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKIILKNNSDFPIYEQIKQQVKQNILKGHVAPGEHLPSMRELAKDLQVSLITTKRAYEDLEKDGFVTTIRGKGTFVKEQDSSILKEKQFFTIENLVKELVNEAQAIEMSLEELQDILTFIYEEESS

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS10745 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]