From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS11140 [old locus tag: NWMN_1931 ]
  • pan locus tag?: SAUPAN005203000
  • symbol: NWMN_RS11140
  • pan gene symbol?: fhuD1
  • synonym:
  • product: ferrichrome-binding protein FhuD

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS11140 [old locus tag: NWMN_1931 ]
  • symbol: NWMN_RS11140
  • product: ferrichrome-binding protein FhuD
  • replicon: chromosome
  • strand: -
  • coordinates: 2138370..2139281
  • length: 912
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (2138370..2139281) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    ATGAAAAGATTAATTGGAATTTTATTATGTAATTTATTTATTTTGACTGCGTGTTCAGCA
    TCTGTCGATAAAACAAGTAACTCGACAAAGACTACAGACTATAAAATTGAAAATGGTGAA
    ACACTGAAAGTACCAGAGAAACCTAAAAGAGTTGCTGTATTAACTGGATTTTATGTTGGT
    GATTTTATAAAGTTAGGAATCAAACCAATTGCTGTTTCAGATATAACTAAAGATTCTTCA
    ATTTTAAAACCTTATTTAAAAGGGGTTGATTATATTGGAGAAAATGATGTTGAAAGAGTT
    GCTAAAGCAAAACCAGATTTAATTGTTGTAGATGCTATGGATAAAAATATAAAAAAATAC
    CAAAAAATAGCGCCAACAATCCCATATACATACAATAAATACAATCATAAAGAAATATTA
    AAAGAAATAGGCAAGTTGACTAATAATGAAGATAAAGCTAAAAAATGGATTGAAGAGTGG
    GACGATAAAACTAGAAAAGATAAAAAAGAAATTCAAAGTAAAATTGGTCAAGCAACAGCA
    TCTGTGTTTGAACCAGATGAAAAGCAAATATACATATATAACTCTACATGGGGTCGTGGT
    TTGGATATTGTTCATGATGCATTCGGTATGCCAATGACAAAGCAATATAAAGATAAATTA
    CAAGAAGATAAAAAAGGCTATGCTTCCATTTCAAAAGAAAATATTAGTAAATATGCTGGT
    GATTATATATTTTTAAGTAAACCTTCGTACGGAAAATTTGATTTTGAAAAAACACATACA
    TGGCAGAATATTGAAGCTGTAAAAAAAGGACATGTAATTTCATATAAAGCAGAAGATTAT
    TGGTTCACAGATCCTATTACATTAGAACATTTGAGAAGTAAATTAAAAAAAGAAATTTTA
    AATAAAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    912

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS11140 [old locus tag: NWMN_1931 ]
  • symbol: NWMN_RS11140
  • description: ferrichrome-binding protein FhuD
  • length: 303
  • theoretical pI: 9.74449
  • theoretical MW: 34842.9
  • GRAVY: -0.646865

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    heme ABC transporter, heme-binding protein isdE (TIGR03659; HMM-score: 26.4)
    putative ABC transporter PGF-CTERM-modified substrate-binding protein (TIGR04281; HMM-score: 15.6)
  • TheSEED:
  • PFAM:
    Chelatase (CL0043) Peripla_BP_2; Periplasmic binding protein (PF01497; HMM-score: 174.4)
    no clan definedRXLR; RXLR phytopathogen effector protein, Avirulence activity (PF16810; HMM-score: 15.1)
    NADH_dhqG_C; NADH-ubiquinone oxidoreductase subunit G, C-terminal (PF09326; HMM-score: 12.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 9.81
    • Cellwall Score: 0.09
    • Extracellular Score: 0.1
    • Internal Helix: 1
  • LocateP:
  • SignalP: Signal peptide length 23 aa
    • Ymax: 0.392
    • Ymax_pos: 23
    • Cmax: 0.172
    • Cmax_pos: 23
    • Smax: 0.945
    • Smax_pos: 15
    • Smean: 0.837
    • D: 0.566
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446748254 NCBI
  • RefSeq: WP_000825510 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKRLIGILLCNLFILTACSASVDKTSNSTKTTDYKIENGETLKVPEKPKRVAVLTGFYVGDFIKLGIKPIAVSDITKDSSILKPYLKGVDYIGENDVERVAKAKPDLIVVDAMDKNIKKYQKIAPTIPYTYNKYNHKEILKEIGKLTNNEDKAKKWIEEWDDKTRKDKKEIQSKIGQATASVFEPDEKQIYIYNSTWGRGLDIVHDAFGMPMTKQYKDKLQEDKKGYASISKENISKYAGDYIFLSKPSYGKFDFEKTHTWQNIEAVKKGHVISYKAEDYWFTDPITLEHLRSKLKKEILNKK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS11140 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]