From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS11640 [old locus tag: NWMN_2013 ]
  • pan locus tag?: SAUPAN005400000
  • symbol: NWMN_RS11640
  • pan gene symbol?: atpB
  • synonym:
  • product: ATP synthase subunit A

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS11640 [old locus tag: NWMN_2013 ]
  • symbol: NWMN_RS11640
  • product: ATP synthase subunit A
  • replicon: chromosome
  • strand: -
  • coordinates: 2230896..2231624
  • length: 729
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (2230896..2231624) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGGATCACAAATCCCCGCTCGTGAGTTGGAATTTATTCGGTTTTGATATCGTTTTCAAT
    TTATCAAGTATATTGATGATACTTGTTACGGCGTTTCTTGTTTTTCTACTTGCTATCATT
    TGTACGCGTAATTTGAAAAAAAGACCAACTGGCAAACAAAATTTCGTTGAATGGATTTTT
    GATTTCGTGAGGGGAATCATTGAAGGTAACATGGCTTGGAAAAAAGGTGGTCAATTCCAC
    TTCTTAGCAGTAACGCTGATTCTGTACATTTTTATAGCTAATATGTTAGGTCTTCCGTTT
    TCTATAGTAACGAAAGATCACACATTGTGGTGGAAATCACCGACAGCTGATGCAACAGTG
    ACTTTAACGTTGTCTACAACGATAATACTGTTAACTCACTTTTATGGAATTAAAATGCGT
    GGTACGAAACAATATCTTAAAGGTTATGTACAGCCGTTTTGGCCATTGGCAATTATTAAT
    GTTTTTGAAGAGTTCACTTCAACATTAACGCTTGGTCTGCGTTTGTACGGTAACATATTT
    GCAGGTGAGATACTATTAACATTACTTGCTGGCTTATTCTTTAACGAACCAGCATGGGGT
    TGGATTATTAGTATCCCAGGATTAATTGTTTGGCAAGCATTTTCAATATTTGTAGGAACA
    ATCCAAGCATATATCTTTATTATGCTTTCGATGGTTTATATGTCACATAAAGTGGCAGAT
    GAACACTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    729

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS11640 [old locus tag: NWMN_2013 ]
  • symbol: NWMN_RS11640
  • description: ATP synthase subunit A
  • length: 242
  • theoretical pI: 9.55099
  • theoretical MW: 27629.7
  • GRAVY: 0.679339

Function[edit source | edit]

  • reaction:
    EC 3.6.3.14?  ExPASy
    H+-transporting two-sector ATPaseATP + H2O + H+(In) = ADP + phosphate + H+(Out)
  • TIGRFAM:
    MetabolismEnergy metabolismATP-proton motive force interconversionATP synthase F0, A subunit (TIGR01131; EC 3.6.3.14; HMM-score: 147.4)
    alternate F1F0 ATPase, F0 subunit A (TIGR03306; EC 3.6.3.-; HMM-score: 77.1)
  • TheSEED:
  • PFAM:
    no clan definedATP-synt_A; ATP synthase A chain (PF00119; HMM-score: 189.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 5
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.139
    • Ymax_pos: 49
    • Cmax: 0.118
    • Cmax_pos: 49
    • Smax: 0.216
    • Smax_pos: 42
    • Smean: 0.091
    • D: 0.12
  • predicted transmembrane helices (TMHMM): 5

Accession numbers[edit source | edit]

  • GI: 446271800 NCBI
  • RefSeq: WP_000349655 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MDHKSPLVSWNLFGFDIVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIFDFVRGIIEGNMAWKKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADATVTLTLSTTIILLTHFYGIKMRGTKQYLKGYVQPFWPLAIINVFEEFTSTLTLGLRLYGNIFAGEILLTLLAGLFFNEPAWGWIISIPGLIVWQAFSIFVGTIQAYIFIMLSMVYMSHKVADEH

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS11640 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]