From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS11865 [old locus tag: NWMN_2054 ]
  • pan locus tag?: SAUPAN005471000
  • symbol: NWMN_RS11865
  • pan gene symbol?:
  • synonym:
  • product: HAD family phosphatase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS11865 [old locus tag: NWMN_2054 ]
  • symbol: NWMN_RS11865
  • product: HAD family phosphatase
  • replicon: chromosome
  • strand: -
  • coordinates: 2272771..2273628
  • length: 858
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (2272771..2273628) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGGATAACGTAAAAGCAATATTTTTGGACATGGATGGAACAATTTTACATGAAAATAAT
    CAAGCATCAACGTATACGAAAGATGTCATTAATCAATTGAGAGAGAAAGGATATAAAGTA
    TTTTTGGCAACAGGACGTTCGCATTCTGAAATACATCAACTTGTACCTCAAGATTTTGCG
    GTTAATGGCATCATTAGTTCAAATGGAACAATTGGAGAAGTAGATGGAGAAATTATCTTC
    AAGCATGGTTTATCATTGGCTCAAGTGCAACAAATTACTAATTTAGCTAAGCGCCAACAA
    ATTTATTATGAGGTATTTCCTTTTGAAGGTAATAGAGTTTCTTTAAAAGAAGATGAAACA
    TGGATGCGAGATATGATTCGTAGTCAAGATCCTATTAATGGCGTAAGTCATAGTGAATGG
    TCTTCAAGACAAGATGCGCTTGCTGGTAAGATAGATTGGGTAACTAAGTTTCCTGAAGGT
    GAATATTCAAAAATTTATCTATTCAGTTCTAATTTAGAAAAAATAACAGCATTTAGAGAT
    GAATTAAAGCAAAATCATGTGCAACTACAGATTAGTGTTTCAAATTCATCAAGATTTAAT
    GCGGAAACAATGGCTTATCAAACTGATAAAGGTACAGGCATTAAAGAAATGATTGCACAT
    TTTGGTATTCATCAAGAAGAAACGTTAGTTATTGGAGATAGCGACAATGATAGAGCAATG
    TTTGAATTTGGTCATTATACAGTTGCTATGAAAAATGCACGCCCTGAAATCCAAGCATTA
    ACTTCAGATGTAACGGCATACACGAATGAAGAGGATGGCGCAGCAAAATATTTAGCAGAG
    CATTTTTTAGCTGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    858

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS11865 [old locus tag: NWMN_2054 ]
  • symbol: NWMN_RS11865
  • description: HAD family phosphatase
  • length: 285
  • theoretical pI: 4.8743
  • theoretical MW: 32297.8
  • GRAVY: -0.488421

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Unknown functionEnzymes of unknown specificityCof-like hydrolase (TIGR00099; HMM-score: 171.3)
    phosphoglycolate phosphatase, TA0175-type (TIGR01487; EC 3.1.3.18; HMM-score: 88.7)
    sucrose-phosphate phosphatase subfamily (TIGR01482; EC 3.1.3.-; HMM-score: 88.6)
    Unknown functionEnzymes of unknown specificityHAD hydrolase, family IIB (TIGR01484; HMM-score: 83.2)
    mannosyl-3-phosphoglycerate phosphatase family (TIGR01486; EC 3.1.3.-; HMM-score: 50.3)
    mannosyl-3-phosphoglycerate phosphatase (TIGR02461; EC 3.1.3.70; HMM-score: 46.9)
    sucrose phosphatase (TIGR01485; EC 3.1.3.24; HMM-score: 38.9)
    Unknown functionEnzymes of unknown specificityHAD hydrolase, family IIIA (TIGR01662; HMM-score: 37.2)
    MetabolismAmino acid biosynthesisSerine familyphosphoserine phosphatase SerB (TIGR00338; EC 3.1.3.3; HMM-score: 32.4)
    Unknown functionGeneralmannosyl-3-phosphoglycerate phosphatase homolog (TIGR02463; EC 3.1.3.-; HMM-score: 30.9)
    sucrose-phosphate synthase, sucrose phosphatase-like domain (TIGR02471; HMM-score: 26.6)
    Unknown functionEnzymes of unknown specificityHAD phosphoserine phosphatase-like hydrolase, family IB (TIGR01488; HMM-score: 24.3)
    HAD phosphatase, family IIIA (TIGR01668; EC 3.1.3.-; HMM-score: 21.3)
    histidinol-phosphate phosphatase domain (TIGR01656; HMM-score: 19.2)
    phosphoserine phosphatase-like hydrolase, archaeal (TIGR01491; HMM-score: 18.7)
    HAD hydrolase, TIGR02253 family (TIGR02253; HMM-score: 18.5)
    Unknown functionEnzymes of unknown specificityHAD hydrolase, family IB (TIGR01490; HMM-score: 18.3)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharides3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family (TIGR01670; EC 3.1.3.45; HMM-score: 18.1)
    Unknown functionEnzymes of unknown specificityHAD hydrolase, family IA, variant 1 (TIGR01549; HMM-score: 13.8)
    phosphonatase-like hydrolase (TIGR03351; HMM-score: 12.7)
  • TheSEED:
  • PFAM:
    HAD (CL0137) Hydrolase_3; haloacid dehalogenase-like hydrolase (PF08282; HMM-score: 178.4)
    S6PP; Sucrose-6F-phosphate phosphohydrolase (PF05116; HMM-score: 57.5)
    Hydrolase; haloacid dehalogenase-like hydrolase (PF00702; HMM-score: 38.1)
    HAD_2; haloacid dehalogenase-like hydrolase (PF13419; HMM-score: 22.1)
    HAD; haloacid dehalogenase-like hydrolase (PF12710; HMM-score: 21.3)
    Hydrolase_6; haloacid dehalogenase-like hydrolase (PF13344; HMM-score: 20.4)
    Acid_phosphat_B; HAD superfamily, subfamily IIIB (Acid phosphatase) (PF03767; HMM-score: 17.3)
    GT-B (CL0113) Glyco_trans_4_2; Glycosyl transferase 4-like (PF13477; HMM-score: 14.6)
    Cache (CL0165) sCache_like; Single Cache-like (PF16736; HMM-score: 13.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.171
    • Ymax_pos: 25
    • Cmax: 0.188
    • Cmax_pos: 25
    • Smax: 0.265
    • Smax_pos: 20
    • Smean: 0.12
    • D: 0.151
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446293069 NCBI
  • RefSeq: WP_000370924 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MDNVKAIFLDMDGTILHENNQASTYTKDVINQLREKGYKVFLATGRSHSEIHQLVPQDFAVNGIISSNGTIGEVDGEIIFKHGLSLAQVQQITNLAKRQQIYYEVFPFEGNRVSLKEDETWMRDMIRSQDPINGVSHSEWSSRQDALAGKIDWVTKFPEGEYSKIYLFSSNLEKITAFRDELKQNHVQLQISVSNSSRFNAETMAYQTDKGTGIKEMIAHFGIHQEETLVIGDSDNDRAMFEFGHYTVAMKNARPEIQALTSDVTAYTNEEDGAAKYLAEHFLAE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS11865 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]