From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS13030 [old locus tag: NWMN_2263 ]
  • pan locus tag?: SAUPAN005870000
  • symbol: NWMN_RS13030
  • pan gene symbol?: hssR
  • synonym:
  • product: DNA-binding response regulator

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS13030 [old locus tag: NWMN_2263 ]
  • symbol: NWMN_RS13030
  • product: DNA-binding response regulator
  • replicon: chromosome
  • strand: +
  • coordinates: 2485824..2486498
  • length: 675
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (2485824..2486498) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGGTGCAATGTCTTGTTGTCGATGACGATCCTCGAATCCTAAATTATATAGCTAGCCAT
    TTACAAATAGAGCACATTGATGCATACACACAACCAAGTGGTGAAGCTGCATTAAAACTT
    TTAGAAAAACAGCGTGTCGATATTGCAGTGGTAGATATTATGATGGATGGTATGGACGGC
    TTTCAATTATGTAATACATTAAAAAATGATTATGATATACCAGTTATTATGTTAACAGCG
    CGGGATGCACTTAGTGACAAAGAGCGTGCGTTTATAAGCGGTACTGACGATTATGTAACC
    AAACCCTTTGAGGTTAAGGAACTTATTTTTAGAATTCGTGCTGTATTACGTCGATATAAT
    ATCAATTCAAATTCAGAAATGACTATTGGCAACTTAACGCTAAACCAATCCTATTTGGAA
    CTCCAAGTATCTAATAAAACGATGACGTTACCGAACAAGGAATTTCAATTATTATTTATG
    CTTGCAGCACGTCCTAAGCAAATCTTTACTCGTGAACAAATAATAGAAAAAATTTGGGGC
    TATGATTATGAAGGAGATGAGCGAACAGTTGACGTTCATATTAAGCGACTACGCCAAAGA
    TTAAAAAAATTAAATGCCACACTTACAATTGAAACAGTAAGAGGACAAGGCTATAAGGTG
    GAGAATCATGTTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    675

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS13030 [old locus tag: NWMN_2263 ]
  • symbol: NWMN_RS13030
  • description: DNA-binding response regulator
  • length: 224
  • theoretical pI: 6.14264
  • theoretical MW: 25957.8
  • GRAVY: -0.301786

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Signal transductionRegulatory functionsDNA interactionsphosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 189.5)
    Signal transductionSignal transductionTwo-component systemsphosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 189.5)
    Signal transductionRegulatory functionsDNA interactionsheavy metal response regulator (TIGR01387; HMM-score: 162.5)
    proteobacterial dedicated sortase system response regulator (TIGR03787; HMM-score: 97.3)
    MetabolismCentral intermediary metabolismNitrogen metabolismnitrogen regulation protein NR(I) (TIGR01818; HMM-score: 61.1)
    Signal transductionRegulatory functionsDNA interactionsnitrogen regulation protein NR(I) (TIGR01818; HMM-score: 61.1)
    Signal transductionSignal transductionTwo-component systemsnitrogen regulation protein NR(I) (TIGR01818; HMM-score: 61.1)
    Cellular processesCellular processesSporulation and germinationsporulation transcription factor Spo0A (TIGR02875; HMM-score: 48.6)
    Signal transductionSignal transductionTwo-component systemsTMAO reductase sytem sensor TorS (TIGR02956; EC 2.7.13.3; HMM-score: 34.7)
    Signal transductionRegulatory functionsDNA interactionsPEP-CTERM-box response regulator transcription factor (TIGR02915; HMM-score: 15.2)
  • TheSEED:
  • PFAM:
    HTH (CL0123) Trans_reg_C; Transcriptional regulatory protein, C terminal (PF00486; HMM-score: 92.1)
    CheY (CL0304) Response_reg; Response regulator receiver domain (PF00072; HMM-score: 92.1)
    HTH (CL0123) HTH_11; HTH domain (PF08279; HMM-score: 13.5)
    Thioredoxin (CL0172) Glutaredoxin; Glutaredoxin (PF00462; HMM-score: 12.8)
    no clan definedCNV-Replicase_N; Replicase polyprotein N-term from Coronavirus nsp1 (PF16688; HMM-score: 12.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.116
    • Ymax_pos: 29
    • Cmax: 0.155
    • Cmax_pos: 29
    • Smax: 0.131
    • Smax_pos: 28
    • Smean: 0.073
    • D: 0.099
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446171636 NCBI
  • RefSeq: WP_000249491 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MVQCLVVDDDPRILNYIASHLQIEHIDAYTQPSGEAALKLLEKQRVDIAVVDIMMDGMDGFQLCNTLKNDYDIPVIMLTARDALSDKERAFISGTDDYVTKPFEVKELIFRIRAVLRRYNINSNSEMTIGNLTLNQSYLELQVSNKTMTLPNKEFQLLFMLAARPKQIFTREQIIEKIWGYDYEGDERTVDVHIKRLRQRLKKLNATLTIETVRGQGYKVENHV

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS13030 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]