From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS13095 [old locus tag: NWMN_2275 ]
  • pan locus tag?: SAUPAN005892000
  • symbol: NWMN_RS13095
  • pan gene symbol?:
  • synonym:
  • product: membrane protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS13095 [old locus tag: NWMN_2275 ]
  • symbol: NWMN_RS13095
  • product: membrane protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2498990..2499421
  • length: 432
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (2498990..2499421) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGCGTAGGTTATTATATTCATTTCTTTTTTATATGATCATAGGTTTATTTAGTGGCTTT
    TTCTATAGAGAGCTAACAAAAGCATATGATTTTACTGGTACAACACAATTATCACTTGTA
    CACACACATACACTTATTTTAGGTATGTTTATGTTTTTAATATTATTACCATTGGAGAAG
    TTATTTAAATTATCAAGTTACTACTTATTTAACTGGTTCTTCTATGTATATAACATAGGT
    GTTATCGTTACTATAGGTATGATGGTGACAAAAGGATTCTTCCAAGTCACTGGTAAATCA
    TACTCTCCAGAAGCATTTGCAGGCTTTGCAGGTATTGGGCACACAGGTATGCTTGCAGGT
    TTATTGTTGCTATTTTTCCTTTTAAGACAAGCAATTCTTAAAGAACCACGTGATGAGTCT
    TTTAAAAAATAA
    60
    120
    180
    240
    300
    360
    420
    432

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS13095 [old locus tag: NWMN_2275 ]
  • symbol: NWMN_RS13095
  • description: membrane protein
  • length: 143
  • theoretical pI: 9.9925
  • theoretical MW: 16589.7
  • GRAVY: 0.64965

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    no clan definedDUF2871; Protein of unknown function (DUF2871) (PF11070; HMM-score: 158.4)
    Cyt_c_ox_IV; Cytochrome c oxidase subunit IV (PF12270; HMM-score: 9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.124
    • Ymax_pos: 29
    • Cmax: 0.168
    • Cmax_pos: 29
    • Smax: 0.239
    • Smax_pos: 2
    • Smean: 0.104
    • D: 0.116
  • predicted transmembrane helices (TMHMM): 4

Accession numbers[edit source | edit]

  • GI: 447176208 NCBI
  • RefSeq: WP_001253464 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MRRLLYSFLFYMIIGLFSGFFYRELTKAYDFTGTTQLSLVHTHTLILGMFMFLILLPLEKLFKLSSYYLFNWFFYVYNIGVIVTIGMMVTKGFFQVTGKSYSPEAFAGFAGIGHTGMLAGLLLLFFLLRQAILKEPRDESFKK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS13095 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]