From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS13195 [old locus tag: NWMN_2294 ]
  • pan locus tag?: SAUPAN005925000
  • symbol: NWMN_RS13195
  • pan gene symbol?: narI
  • synonym:
  • product: nitrate reductase subunit gamma

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS13195 [old locus tag: NWMN_2294 ]
  • symbol: NWMN_RS13195
  • product: nitrate reductase subunit gamma
  • replicon: chromosome
  • strand: -
  • coordinates: 2518936..2519613
  • length: 678
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (2518936..2519613) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGCTTAATCAGTTTTTATGGGTTATATTTCCGTATTTATGTTTAGTTGTCTTTGTCGCA
    GGTCATATTGCACGTTATCGTTATGATAAATTTTCTTGGACAGCTAAATCTAGTGAATTA
    ATAGAAAGAAAAAGGTTGATGTGGGGAAGTTTATTATTTCACTTAGGTATTATTCCAGTG
    TTTTTTGGACACGTAGTTGGATTGTTAATACCGAAACCATGGATGGATGCAGTGGGTGTG
    TCTGAGCATTTATATCATATAGGCGCTGTTTATATTGGTAGCATCTTTGGTATAATAACT
    TTGATAGGGATGTTTTTATTAACAGCGAGACGTGTTACTACGAAAAGTATTCGAAGATTA
    AGTTCAGCGTCGGATATATTTGTAAATTTCTTATTATTACTTATCGTATTTATGGGATGT
    TACGCAACATTAGTAACAAATATACAACATCCAGACTTTAACTACAGAACTTCATTATCA
    ATTTGGTTTAGACAATTATTTATGTTAAAACCAGATGCGTCATTGATGAGTGGTGTGCCG
    ATTGCATTTAAAATGCATATATTGTTAGGTTTCACTATTATGGCTTGTTGGCCATTTACA
    CGTTTGGTGCATGTTTGGAGTGTACCTTTGACATATATAAATCGCAGATATATTATTTAC
    CGTAAGAATAAAGTGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    678

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS13195 [old locus tag: NWMN_2294 ]
  • symbol: NWMN_RS13195
  • description: nitrate reductase subunit gamma
  • length: 225
  • theoretical pI: 10.5772
  • theoretical MW: 26145.3
  • GRAVY: 0.651111

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismEnergy metabolismAnaerobicrespiratory nitrate reductase, gamma subunit (TIGR00351; EC 1.7.99.4; HMM-score: 238.5)
  • TheSEED:
  • PFAM:
    no clan definedNitrate_red_gam; Nitrate reductase gamma subunit (PF02665; HMM-score: 293.6)
    UPF0114; Uncharacterized protein family, UPF0114 (PF03350; HMM-score: 13.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 5
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.122
    • Ymax_pos: 12
    • Cmax: 0.115
    • Cmax_pos: 27
    • Smax: 0.243
    • Smax_pos: 6
    • Smean: 0.158
    • D: 0.136
  • predicted transmembrane helices (TMHMM): 5

Accession numbers[edit source | edit]

  • GI: 446856895 NCBI
  • RefSeq: WP_000934151 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MLNQFLWVIFPYLCLVVFVAGHIARYRYDKFSWTAKSSELIERKRLMWGSLLFHLGIIPVFFGHVVGLLIPKPWMDAVGVSEHLYHIGAVYIGSIFGIITLIGMFLLTARRVTTKSIRRLSSASDIFVNFLLLLIVFMGCYATLVTNIQHPDFNYRTSLSIWFRQLFMLKPDASLMSGVPIAFKMHILLGFTIMACWPFTRLVHVWSVPLTYINRRYIIYRKNKV

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS13195 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]