From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS13205 [old locus tag: NWMN_2296 ]
  • pan locus tag?: SAUPAN005927000
  • symbol: NWMN_RS13205
  • pan gene symbol?: narH
  • synonym:
  • product: nitrate reductase subunit beta

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS13205 [old locus tag: NWMN_2296 ]
  • symbol: NWMN_RS13205
  • product: nitrate reductase subunit beta
  • replicon: chromosome
  • strand: -
  • coordinates: 2520174..2521733
  • length: 1560
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (2520174..2521733) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    1261
    1321
    1381
    1441
    1501
    TTGAAGATTAAAGCGCAAGTTGCGATGGTATTAAATTTAGATAAATGCATAGGATGCCAT
    ACGTGTAGTGTGACATGTAAAAACACTTGGACAAATCGTCCAGGTGCTGAGTACATGTGG
    TTCAACAACGTAGAAACGAAGCCAGGTGTAGGGTATCCGAAACGTTGGGAAGACCAAGAA
    CACTACAAAGGTGGTTGGGTACTAAATCGTAAAGGGAAACTTGAATTAAAATCTGGAAGT
    AGAATTTCAAAAATTGCTTTAGGTAAAATTTTTTATAACCCAGATATGCCATTAATTAAA
    GATTATTATGAGCCATGGAACTATAATTATGAACATTTAACAACTGCGAAATCAGGGAAG
    CATTCGCCAGTTGCTAGAGCGTATTCAGAAATTACGGGGGATAACATTGAAATTGAATGG
    GGACCTAACTGGGAAGATGACTTAGCAGGTGGTCATGTTACAGGTCCAAAAGATCCTAAC
    ATCCAAAAAATAGAAGAAGATATTAAATTCCAATTTGACGAAACTTTTATGATGTATTTA
    CCACGTTTATGTGAACATTGCTTGAATCCAAGTTGCGTTGCATCGTGTCCTTCAGGTGCT
    ATGTATAAACGTGATGAAGATGGCATTGTATTAGTTGACCAAGACGCATGTCGTGGATGG
    CGTTACTGTATGACAGGTTGTCCATATAAGAAAGTTTACTTCAATTGGAAAACGAACAAA
    GCTGAAAAGTGTACTTTCTGTTTCCCGAGAATCGAGGCGGGTATGCCTACGGTATGCTCT
    GAAACTTGTACAGGACGTATGCGTTACTTAGGTGTTTTATTATATGATGCAGATCGAGTT
    CATGAAGCAGCTTCAGCAGTAGACGAGAAAGATTTATATGAAAAACAATTAGATATATTC
    TTAAACCCATTTGACGAAGAAGTCATTGCTCAAGCTGAAAAAGATGGTATTGGTTACGAT
    TGGATTGAAGCTGCACAAAACTCTCCAATTTATAAGTTAGCAATTGAATATAAACTTGCA
    TTTCCGTTACATCCTGAATTTAGAACGATGCCGATGGTTTGGTATTGCCCACCACTTAGC
    CCAATTATGAGCTATTTTGAAGGTAAAAATACAACTCAAAATCCAGATGCGATTTTCCCA
    GCCATTGAAGAAATGCGTTTACCTATTGAATACTTAGCTAATATTTTCACTGCAGGAGAT
    ACAGAGCCAGTAAAAGGAGCCCTACAACGTATGGCAATGATGAGAAGTTATATGAGATCT
    CAAGTTACTCAACAGCCATTTGACACGTCTCGATTAGAGCGATTAGGTATAACCGAGCGC
    CAAACTAAAGACATGTATCGTTTATTAGGACTAGCCAAATATGAAGATCGATTTGTTATT
    CCAACATCACACAAAGAAACCTATTTAGATACGTATCACGCACAAGGTAGTACAGGATAC
    AATTACGGCGGCGAGCATTTTGGAGATAACTGTGAAGGCTGTGGCGTTGCAGTAGGTTCA
    GGGAAAACTGGTCAAGAAATTTATAATGAGAATTTCTATGGAGGGATTTTCCGTGATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1260
    1320
    1380
    1440
    1500
    1560

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS13205 [old locus tag: NWMN_2296 ]
  • symbol: NWMN_RS13205
  • description: nitrate reductase subunit beta
  • length: 519
  • theoretical pI: 5.54155
  • theoretical MW: 59430.2
  • GRAVY: -0.536609

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismEnergy metabolismAnaerobicnitrate reductase, beta subunit (TIGR01660; EC 1.7.99.4; HMM-score: 841.3)
    MetabolismEnergy metabolismAnaerobicDMSO reductase family type II enzyme, iron-sulfur subunit (TIGR03478; HMM-score: 288.5)
    MetabolismEnergy metabolismElectron transportDMSO reductase family type II enzyme, iron-sulfur subunit (TIGR03478; HMM-score: 288.5)
    dimethylsulfoxide reductase, chain B (TIGR02951; HMM-score: 107.1)
    MetabolismEnergy metabolismElectron transportcytochrome c nitrite reductase, Fe-S protein (TIGR03149; EC 1.7.2.2; HMM-score: 86.9)
    MetabolismEnergy metabolismAnaerobicformate dehydrogenase, beta subunit (TIGR01582; EC 1.2.1.2; HMM-score: 71.2)
    MetabolismEnergy metabolismElectron transportformate dehydrogenase, beta subunit (TIGR01582; EC 1.2.1.2; HMM-score: 71.2)
    Unknown functionGeneralarchaeoflavoprotein, MJ0208 family (TIGR02700; HMM-score: 23.5)
    [FeFe] hydrogenase, group B1/B3 (TIGR04105; EC 1.12.-.-; HMM-score: 22.6)
    2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family (TIGR02179; HMM-score: 16.2)
    MetabolismCentral intermediary metabolismNitrogen fixationferredoxin III, nif-specific (TIGR02936; HMM-score: 14.9)
    methylamine methyltransferase corrinoid protein reductive activase (TIGR04270; HMM-score: 14.8)
    MetabolismEnergy metabolismAmino acids and aminescholine TMA-lyase-activating enzyme (TIGR04395; EC 1.97.-.-; HMM-score: 14.5)
    Genetic information processingProtein fateProtein modification and repairglycine radical enzyme activase, YjjW family (TIGR04041; EC 1.97.1.-; HMM-score: 13.6)
    glycyl-radical enzyme activating protein (TIGR02494; EC 1.97.1.-; HMM-score: 12.2)
    MetabolismCentral intermediary metabolismSulfur metabolismsulfite reductase, dissimilatory-type beta subunit (TIGR02066; EC 1.8.99.3; HMM-score: 10.9)
    coenzyme F420 hydrogenase, subunit gamma (TIGR03294; EC 1.12.98.1; HMM-score: 9.2)
    [FeFe] hydrogenase, group A (TIGR02512; EC 1.12.-.-; HMM-score: 7.5)
    MetabolismEnergy metabolismElectron transportelectron transport complex, RnfABCDGE type, B subunit (TIGR01944; HMM-score: 5.8)
    MetabolismEnergy metabolismMethanogenesisputative methanogenesis marker 16 metalloprotein (TIGR03287; HMM-score: 4.3)
    MetabolismCentral intermediary metabolismSulfur metabolismsulfite reductase, subunit C (TIGR02912; EC 1.8.-.-; HMM-score: 4)
    MetabolismEnergy metabolismOtherbenzoyl-CoA oxygenase/reductase, BoxA protein (TIGR03224; EC 1.14.12.21; HMM-score: 3.9)
  • TheSEED:
  • PFAM:
    4Fe-4S (CL0344) Fer4_11; 4Fe-4S dicluster domain (PF13247; HMM-score: 123.6)
    no clan definedNitr_red_bet_C; Respiratory nitrate reductase beta C-terminal (PF14711; HMM-score: 100.3)
    4Fe-4S (CL0344) Fer4_10; 4Fe-4S dicluster domain (PF13237; HMM-score: 29.6)
    Fer4_7; 4Fe-4S dicluster domain (PF12838; HMM-score: 24.7)
    Fer4_6; 4Fe-4S binding domain (PF12837; HMM-score: 22)
    Fer4_9; 4Fe-4S dicluster domain (PF13187; HMM-score: 19.2)
    Fer4_2; 4Fe-4S binding domain (PF12797; HMM-score: 15.5)
    Fer4; 4Fe-4S binding domain (PF00037; HMM-score: 15)
    Fer4_13; 4Fe-4S single cluster domain of Ferredoxin I (PF13370; HMM-score: 13.8)
    Fer4_8; 4Fe-4S dicluster domain (PF13183; HMM-score: 11.7)
    Fer4_21; 4Fe-4S dicluster domain (PF14697; HMM-score: 9.1)
    Fer4_4; 4Fe-4S binding domain (PF12800; HMM-score: 8.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.05
    • Cytoplasmic Membrane Score: 8.78
    • Cellwall Score: 0.08
    • Extracellular Score: 0.09
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.28
    • Ymax_pos: 20
    • Cmax: 0.126
    • Cmax_pos: 37
    • Smax: 0.827
    • Smax_pos: 16
    • Smean: 0.597
    • D: 0.404
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446615299 NCBI
  • RefSeq: WP_000692645 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKIKAQVAMVLNLDKCIGCHTCSVTCKNTWTNRPGAEYMWFNNVETKPGVGYPKRWEDQEHYKGGWVLNRKGKLELKSGSRISKIALGKIFYNPDMPLIKDYYEPWNYNYEHLTTAKSGKHSPVARAYSEITGDNIEIEWGPNWEDDLAGGHVTGPKDPNIQKIEEDIKFQFDETFMMYLPRLCEHCLNPSCVASCPSGAMYKRDEDGIVLVDQDACRGWRYCMTGCPYKKVYFNWKTNKAEKCTFCFPRIEAGMPTVCSETCTGRMRYLGVLLYDADRVHEAASAVDEKDLYEKQLDIFLNPFDEEVIAQAEKDGIGYDWIEAAQNSPIYKLAIEYKLAFPLHPEFRTMPMVWYCPPLSPIMSYFEGKNTTQNPDAIFPAIEEMRLPIEYLANIFTAGDTEPVKGALQRMAMMRSYMRSQVTQQPFDTSRLERLGITERQTKDMYRLLGLAKYEDRFVIPTSHKETYLDTYHAQGSTGYNYGGEHFGDNCEGCGVAVGSGKTGQEIYNENFYGGIFRD

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS13205 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]