From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS13820 [old locus tag: NWMN_2403 ]
  • pan locus tag?: SAUPAN006132000
  • symbol: NWMN_RS13820
  • pan gene symbol?: gntR
  • synonym:
  • product: GntR family transcriptional regulator

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS13820 [old locus tag: NWMN_2403 ]
  • symbol: NWMN_RS13820
  • product: GntR family transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 2645363..2646043
  • length: 681
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (2645363..2646043) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGATGTATGGATATCCAGAGAAATGGTTGGAAGGTATGACAACTGGAGAAGGTATCGCG
    GCAGAATTACGCTTAGGCATTGTGAATGGTCACATAGCTGAAGGTACGTTACTCACTGAA
    AATCAAATGGCAAAGCAATTTAATGTGAGTCGTTCGCCAATTCGAGATGCATTTAAATTA
    TTGCAACAAAATCAACTCATCCAATTAGAAAGAATGGGTGCACATGTGTTGCCGTTTGGG
    GAACAAGAAAAGAAAGAAATGTATGATTTGCGACTGATGTTAGAGTCATTTGCATTTTCA
    AGAGTTAAAAATCAAGAGCGACTACCTATCGTAAAAGAAATGAAGAAACAACTTGAAATG
    ATGAAAGTGGCAGTAAAATTTGAGGATGCAGAATCATTTACGAAGCATGACTTTGAATTT
    CATGAAACATTAATCAAAGCATCTAATCATCAATATTTAAACTCATTTTGGAGTCATTTA
    AAACCAGTAATGATGGCACTCGTTTTAACATCCATGCGACAACGTATGCAACAGAACCCG
    CAAGATTTTGAACGCATACATCATAATCATCAAGTGTTTATTGATGCAGTGGAACAATAC
    GACAGTCAAATTTTGAAAGAAGCGTTTCATTTAAATTTCGACGATGTTGGTAAAGATATT
    GAAGGATTTTGGTTGAATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    681

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS13820 [old locus tag: NWMN_2403 ]
  • symbol: NWMN_RS13820
  • description: GntR family transcriptional regulator
  • length: 226
  • theoretical pI: 6.35132
  • theoretical MW: 26595.4
  • GRAVY: -0.469912

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    phosphonate utilization associated transcriptional regulator (TIGR03338; HMM-score: 85.1)
    Signal transductionRegulatory functionsDNA interactionstrehalose operon repressor (TIGR02404; HMM-score: 26.5)
    MetabolismTransport and binding proteinsAnionsphosphonate metabolism transcriptional regulator PhnF (TIGR02325; HMM-score: 24.4)
    Signal transductionRegulatory functionsDNA interactionsphosphonate metabolism transcriptional regulator PhnF (TIGR02325; HMM-score: 24.4)
    MetabolismEnergy metabolismAmino acids and amineshistidine utilization repressor (TIGR02018; HMM-score: 16.2)
    Signal transductionRegulatory functionsDNA interactionshistidine utilization repressor (TIGR02018; HMM-score: 16.2)
    MetabolismFatty acid and phospholipid metabolismBiosynthesisfatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 12.9)
    MetabolismFatty acid and phospholipid metabolismDegradationfatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 12.9)
    Signal transductionRegulatory functionsDNA interactionsfatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 12.9)
  • TheSEED:
  • PFAM:
    FadR-C (CL0388) FCD; FCD domain (PF07729; HMM-score: 71.6)
    HTH (CL0123) GntR; Bacterial regulatory proteins, gntR family (PF00392; HMM-score: 47.3)
    HTH_41; Helix-turn-helix domain (PF14502; HMM-score: 19.7)
    FadR-C (CL0388) FadR_C; FadR C-terminal domain (PF07840; HMM-score: 16.2)
    HTH (CL0123) HTH_11; HTH domain (PF08279; HMM-score: 13.3)
    ATP-grasp (CL0179) DUF1297; Domain of unknown function (DUF1297) (PF06973; HMM-score: 12.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.108
    • Ymax_pos: 33
    • Cmax: 0.121
    • Cmax_pos: 33
    • Smax: 0.139
    • Smax_pos: 41
    • Smean: 0.089
    • D: 0.101
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446912877 NCBI
  • RefSeq: WP_000990133 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MMYGYPEKWLEGMTTGEGIAAELRLGIVNGHIAEGTLLTENQMAKQFNVSRSPIRDAFKLLQQNQLIQLERMGAHVLPFGEQEKKEMYDLRLMLESFAFSRVKNQERLPIVKEMKKQLEMMKVAVKFEDAESFTKHDFEFHETLIKASNHQYLNSFWSHLKPVMMALVLTSMRQRMQQNPQDFERIHHNHQVFIDAVEQYDSQILKEAFHLNFDDVGKDIEGFWLN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS13820 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]