From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS14315 [old locus tag: NWMN_2494 ]
  • pan locus tag?: SAUPAN006281000
  • symbol: NWMN_RS14315
  • pan gene symbol?: panD
  • synonym:
  • product: aspartate 1-decarboxylase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS14315 [old locus tag: NWMN_2494 ]
  • symbol: NWMN_RS14315
  • product: aspartate 1-decarboxylase
  • replicon: chromosome
  • strand: -
  • coordinates: 2739782..2740153
  • length: 372
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (2739782..2740153) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGATGAATGCTAAAATTCATAGAGCAAGAGTGACTGAGTCAAATTTAAATTATGTAGGT
    AGCATTACGATTGATTCAGATATATTGGAAGCGGTAGACATCTTGCCAAATGAAAAAGTA
    GCCATCGTGAATAATAATAATGGTGCACGTTTTGAAACATACGTAATAGCTGGTGAAAGA
    GGTAGTGGTAAAATTTGTTTAAACGGTGCAGCGTCAAGACTTGTTGAAGTAGGCGATGTA
    GTCATAATCATGACTTATGCACAGTTGAATGAAGAAGAAATTAAAAACCATGCACCTAAA
    GTAGCAGTAATGAATGAAGATAATGTCATTATTGAAATGATTCATGAAAAAGAAAATACG
    ATAGTGTTATAA
    60
    120
    180
    240
    300
    360
    372

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS14315 [old locus tag: NWMN_2494 ]
  • symbol: NWMN_RS14315
  • description: aspartate 1-decarboxylase
  • length: 123
  • theoretical pI: 4.6011
  • theoretical MW: 13548.4
  • GRAVY: -0.00731707

Function[edit source | edit]

  • reaction:
    EC 4.1.1.11?  ExPASy
    Aspartate 1-decarboxylaseL-aspartate = beta-alanine + CO2
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersPantothenate and coenzyme Aaspartate 1-decarboxylase (TIGR00223; EC 4.1.1.11; HMM-score: 172.6)
    crotonyl-CoA carboxylase/reductase (TIGR01751; EC 1.3.1.85; HMM-score: 16.9)
  • TheSEED:
  • PFAM:
    AcetylDC-like (CL0332) Asp_decarbox; Aspartate decarboxylase (PF02261; HMM-score: 169.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: pyruvate
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.175
    • Ymax_pos: 11
    • Cmax: 0.12
    • Cmax_pos: 50
    • Smax: 0.476
    • Smax_pos: 1
    • Smean: 0.254
    • D: 0.206
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI:
  • RefSeq: WP_001789904 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MMNAKIHRARVTESNLNYVGSITIDSDILEAVDILPNEKVAIVNNNNGARFETYVIAGERGSGKICLNGAASRLVEVGDVVIIMTYAQLNEEEIKNHAPKVAVMNEDNVIIEMIHEKENTIVL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS14315 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]