From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS14920 [old locus tag: NWMN_2605 ]
  • pan locus tag?: SAUPAN006479000
  • symbol: NWMN_RS14920
  • pan gene symbol?: cspB
  • synonym:
  • product: cold-shock protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS14920 [old locus tag: NWMN_2605 ]
  • symbol: NWMN_RS14920
  • product: cold-shock protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2870583..2870783
  • length: 201
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (2870583..2870783) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    ATGAATAACGGTACAGTAAAATGGTTTAACGCAGAAAAAGGTTTTGGTTTCATCGAACAA
    GAAAATGGCGGAGACGTATTCGTACATTTCTCAGGTATCGCTAGCGATGGCTACAAAACT
    TTAGAAGAAGGTCAAAAAGTTACTTTCGAAATCACTGAAGGTCAACGTGGAGACCAAGCA
    GTTAACGTACAAACTGTTTAA
    60
    120
    180
    201

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS14920 [old locus tag: NWMN_2605 ]
  • symbol: NWMN_RS14920
  • description: cold-shock protein
  • length: 66
  • theoretical pI: 4.25084
  • theoretical MW: 7257.87
  • GRAVY: -0.512121

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesAdaptations to atypical conditionscold shock domain protein CspD (TIGR02381; HMM-score: 90.2)
    Genetic information processingDNA metabolismDNA replication, recombination, and repaircold shock domain protein CspD (TIGR02381; HMM-score: 90.2)
  • TheSEED:
  • PFAM:
    OB (CL0021) CSD; 'Cold-shock' DNA-binding domain (PF00313; HMM-score: 100.3)
    S1; S1 RNA binding domain (PF00575; HMM-score: 19.9)
    OB_RNB; Ribonuclease B OB domain (PF08206; HMM-score: 15.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.103
    • Ymax_pos: 11
    • Cmax: 0.109
    • Cmax_pos: 29
    • Smax: 0.145
    • Smax_pos: 2
    • Smean: 0.098
    • D: 0.101
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446981823 NCBI
  • RefSeq: WP_001059079 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MNNGTVKWFNAEKGFGFIEQENGGDVFVHFSGIASDGYKTLEEGQKVTFEITEGQRGDQAVNVQTV

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS14920 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]