From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS14940 [old locus tag: NWMN_2609 ]
  • pan locus tag?: SAUPAN006486000
  • symbol: NWMN_RS14940
  • pan gene symbol?: noc
  • synonym:
  • product: nucleoid occlusion protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS14940 [old locus tag: NWMN_2609 ]
  • symbol: NWMN_RS14940
  • product: nucleoid occlusion protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2873009..2873848
  • length: 840
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (2873009..2873848) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGAAAAAACCTTTTTCAAAATTATTTGGTTTGAAAAACAAAGATGACATCATTGGACAT
    ATTGAAGAAGATCGCAATAGTAATGTTGAATCCATTCAAATTGAACGTATCGTTCCCAAC
    CGTTATCAACCAAGACAGGTGTTTGAACCAAATAAAATTAAAGAACTTGCTGAATCAATA
    CATGAACATGGTTTACTACAACCTATTGTTGTAAGACCGATTGAAGAAGATATGTTTGAA
    ATTATTGCTGGAGAGCGCCGATTTAGAGCAATACAATCACTAAATTTACCTCAAGCAGAC
    GTTATTATTCGTGATATGGATGATGAAGAGACGGCTGTTGTTGCATTAATTGAGAATATT
    CAAAGAGAAAATTTGTCTGTTGTTGAAGAAGCGGAAGCCTATAAGAAATTATTGGAAATT
    GGTGATACAACGCAAAGTGAATTGGCAAAAAGTTTAGGTAAAAGTCAAAGCTTTATTGCA
    AATAAGTTGCGTTTATTGAAGTTGGCGCCGAAAGTACTACTTCGCTTAAGAGAAGGTAAA
    ATTACTGAACGTCATGCGAGAGCGGTATTATCATTGTCTGATAGCGAACAAGAAGCGTTG
    ATTGAGCAAGTCATTGCACAAAAGCTAAATGTGAAACAGACTGAAGATAGAGTACGCCAA
    AAAACGGGGCCCGAAAAAGTCAAAGCACAAAACCTTCGCTTTGCACAAGATGTCACTCAA
    GCACGAGATGAGGTAGGCAAAAGTATCCAAGCGATTCAACAAACAGGATTACATGTTGAG
    CATAAAGACAAAGATCATGAAGATTATTATGAAATAAAAATTCGAATATATAAACGTTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS14940 [old locus tag: NWMN_2609 ]
  • symbol: NWMN_RS14940
  • description: nucleoid occlusion protein
  • length: 279
  • theoretical pI: 6.90987
  • theoretical MW: 32196.6
  • GRAVY: -0.620072

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    nucleoid occlusion protein (TIGR04285; HMM-score: 318)
    ParB/RepB/Spo0J family partition protein (TIGR00180; HMM-score: 185.8)
    PRTRC system ParB family protein (TIGR03734; HMM-score: 140.9)
    Genetic information processingMobile and extrachromosomal element functionsPlasmid functionsplasmid partitioning protein RepB (TIGR03454; HMM-score: 61.6)
    Signal transductionRegulatory functionsDNA interactionsCRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 14.8)
  • TheSEED:
  • PFAM:
    ParBc (CL0248) ParBc; ParB-like nuclease domain (PF02195; HMM-score: 89.4)
    HTH (CL0123) KorB; KorB domain (PF08535; HMM-score: 21.2)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 17.5)
    HTH_5; Bacterial regulatory protein, arsR family (PF01022; HMM-score: 14.4)
    HTH_3; Helix-turn-helix (PF01381; HMM-score: 12.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.123
    • Ymax_pos: 11
    • Cmax: 0.112
    • Cmax_pos: 48
    • Smax: 0.225
    • Smax_pos: 3
    • Smean: 0.132
    • D: 0.127
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446665491 NCBI
  • RefSeq: WP_000742837 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKKPFSKLFGLKNKDDIIGHIEEDRNSNVESIQIERIVPNRYQPRQVFEPNKIKELAESIHEHGLLQPIVVRPIEEDMFEIIAGERRFRAIQSLNLPQADVIIRDMDDEETAVVALIENIQRENLSVVEEAEAYKKLLEIGDTTQSELAKSLGKSQSFIANKLRLLKLAPKVLLRLREGKITERHARAVLSLSDSEQEALIEQVIAQKLNVKQTEDRVRQKTGPEKVKAQNLRFAQDVTQARDEVGKSIQAIQQTGLHVEHKDKDHEDYYEIKIRIYKR

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS14940 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]