From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0020 [new locus tag: SA_RS00255 ]
  • pan locus tag?: SAUPAN000035000
  • symbol: SA0020
  • pan gene symbol?: walI
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0020 [new locus tag: SA_RS00255 ]
  • symbol: SA0020
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 28802..29590
  • length: 789
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGAACTGGAAACTGACAAAGACACTTTTCATTTTCGTGTTTATTCTTGTCAACATCGTG
    TTAGTATCGATTTATGTTAATAAAGTCAATCGCTCACACATTAATGAAGTTGAGAGTAAC
    AATGAAGTTAATTTTCAGCAAGAAGAAATTAAAGTACCGGCTAGTATATTGAATAAATCA
    GTTAAAGGTATAAAATTAGAGCAAATTACAGGGCGATCAAAAGACTTTAGTTCTAAAGCT
    AAGGGCGATTCGGATTTGACCACATCAGATGGTGGAAAATTATTGAATGCGAACATTAGT
    CAATCGGTAAAGGTCAGTGACAATAACTTAAAAGATTTGAAAGATTATGTTAACAAACGT
    GTGTTCAAAGGTTCAGAATATCAATTAAGTGAAATTAATTCTGGTTCTGTAAAATACGAA
    CAAACGTATGATAATTTCCCGATTTTGAACAATAGTAAAGCGATGTTGAACTTTAATATA
    GAAGATAACAAAGCGGCTAGTTATAAACAATCAATGATGGATGACATTAAGCCCACAGAT
    GGTGCAGATAAGAAGCATCAAGTTATTGGAGTGAGAAAAGCAATCGAGGCATTATATTAT
    AATCGTTACTTGAAAAAAGGTGATGAAGTCATTAATGCTAGACTCGGTTACTACTCAGTC
    GTGAACGAAACGAATGTTCAATTGTTACAACCAAACTGGGAAATTAAAGTGAAGCATGAC
    GGTAAGGACAAAACGAATACTTACTATGTCGAAGCGACAAATAATAACCCTAAAATTATT
    AATCATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    789

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0020 [new locus tag: SA_RS00255 ]
  • symbol: SA0020
  • description: hypothetical protein
  • length: 262
  • theoretical pI: 9.61263
  • theoretical MW: 29855.6
  • GRAVY: -0.611069

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    CPO analysis Two-component system YycFG regulatory protein YycI 
  • PFAM:
    YycI_YycH (CL0285) YycI; YycH protein (PF09648; HMM-score: 171.4)
    Adhesin (CL0204) FimH_man-bind; FimH, mannose binding (PF09160; HMM-score: 13.9)
    no clan definedDUF2730; Protein of unknown function (DUF2730) (PF10805; HMM-score: 13.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.268
    • Ymax_pos: 35
    • Cmax: 0.152
    • Cmax_pos: 35
    • Smax: 0.628
    • Smax_pos: 29
    • Smean: 0.375
    • D: 0.309
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNWKLTKTLFIFVFILVNIVLVSIYVNKVNRSHINEVESNNEVNFQQEEIKVPASILNKSVKGIKLEQITGRSKDFSSKAKGDSDLTTSDGGKLLNANISQSVKVSDNNLKDLKDYVNKRVFKGSEYQLSEINSGSVKYEQTYDNFPILNNSKAMLNFNIEDNKAASYKQSMMDDIKPTDGADKKHQVIGVRKAIEALYYNRYLKKGDEVINARLGYYSVVNETNVQLLQPNWEIKVKHDGKDKTNTYYVEATNNNPKIINH

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]

Olivier Poupel, Mati Moyat, Julie Groizeleau, Luísa C S Antunes, Simonetta Gribaldo, Tarek Msadek, Sarah Dubrac
Transcriptional Analysis and Subcellular Protein Localization Reveal Specific Features of the Essential WalKR System in Staphylococcus aureus.
PLoS ONE: 2016, 11(3);e0151449
[PubMed:26999783] [WorldCat.org] [DOI] (I e)