From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0124 [new locus tag: SA_RS00785 ]
  • pan locus tag?: SAUPAN000938000
  • symbol: SA0124
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0124 [new locus tag: SA_RS00785 ]
  • symbol: SA0124
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 143078..143770
  • length: 693
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    TTGAAGAAGTTACAGCTAAAGAAGTGGAAATGTCGTGAAAATGACATTGAAGCTGTCCAT
    AATAATAAGGGTTATGCCTATCAAAGAAAATTAGATGCACTCGAAGAAGTGAGAAAAGGC
    TATTACCCAATTAAACGTGCGATTGACTTAGTATTAAGTATCGTTTTATTATTTTTAACA
    TTTCCGATTATGTTCATATTCGCCATTGCTATCGTCATAGATTCGCCAGGAAACCCTATT
    TATAGTCAGGTTAGAGTTGGGAAGATGGGTAAATTAATTAAAATATACAAATTACGTTCG
    ATGTGTAAAAACGCAGAGAAAAATGGTGCGCAATGGGCTGATAAAGATGATGATCGTATA
    ACAAATGTCGGGAAGTTTATTCGTAAAACACGCATTGATGAATTACCACAACTAATTAAT
    GTTGTTAAAGGGGAAATGAGTTTTATTGGACCACGCCCGGAACGTCCGGAATTTGTAGAA
    TTATTTAGTTCAGAAGTGATAGGTTTCGAGCAAAGATGTCTTGTTACACCAGGGTTAACA
    GGACTTGCGCAAATTCAAGGTGGATATGACTTAACACCGCAACAAAAACTGAAATATGAC
    ATGAAATATATACATAAAGGTAGTTTAATGATGGAACTATATATATCAATTAGAACATTG
    ATGGTTGTTATTACAGGGGAAGGCTCAAGGTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    693

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0124 [new locus tag: SA_RS00785 ]
  • symbol: SA0124
  • description: hypothetical protein
  • length: 230
  • theoretical pI: 10.0408
  • theoretical MW: 26424
  • GRAVY: -0.186522

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase (TIGR03025; HMM-score: 271.6)
    sugar transferase, PEP-CTERM system associated (TIGR03013; HMM-score: 237.7)
    undecaprenyl-phosphate glucose phosphotransferase (TIGR03023; EC 2.7.8.-; HMM-score: 228)
    undecaprenyl-phosphate galactose phosphotransferase WbaP (TIGR03022; EC 2.7.8.6; HMM-score: 174.9)
  • TheSEED:  
    Putative undecaprenyl-phosphate N-acetylgalactosaminyl 1-phosphate transferase 
    teichuronic acid biosynthesis glycosyltransferase TuaA 
  • PFAM:
    no clan definedBac_transf; Bacterial sugar transferase (PF02397; HMM-score: 207.6)
    SLC3A2_N; Solute carrier family 3 member 2 N-terminus (PF16028; HMM-score: 11.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.05
    • Cytoplasmic Membrane Score: 8.78
    • Cellwall Score: 0.08
    • Extracellular Score: 0.09
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.127
    • Ymax_pos: 11
    • Cmax: 0.115
    • Cmax_pos: 68
    • Smax: 0.214
    • Smax_pos: 3
    • Smean: 0.167
    • D: 0.143
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKKLQLKKWKCRENDIEAVHNNKGYAYQRKLDALEEVRKGYYPIKRAIDLVLSIVLLFLTFPIMFIFAIAIVIDSPGNPIYSQVRVGKMGKLIKIYKLRSMCKNAEKNGAQWADKDDDRITNVGKFIRKTRIDELPQLINVVKGEMSFIGPRPERPEFVELFSSEVIGFEQRCLVTPGLTGLAQIQGGYDLTPQQKLKYDMKYIHKGSLMMELYISIRTLMVVITGEGSR

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]