From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000938000
  • symbol?:
  • description?: UDP-phosphate N-acetylgalactosaminyl-1-phosphate transferase

      descriptions from strain specific annotations:

    • UDP-phosphate N-acetylgalactosaminyl-1-phosphate transferase
    • capsular polysaccharide biosynthesis glycosyltransferase
    • sugar transferase
    • putative sugar transferase
    • bacterial sugar transferase family protein
    • capsular polysaccharide biosynthesis protein
    • Putative undecaprenyl-phosphate N-acetylgalactosaminyl 1-phosphate transferase
    • sugar transferase family protein
    • teichuronic acid biosynthesis glycosyltransferase TuaA
    • undecaprenyl-phosphate galactose phosphotransferase
  • strand?: +
  • coordinates?: 1198422..1199114
  • synteny block?: BlockID0004740
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0130
    08BA02176:
    C248_0118
    11819-97:
    MS7_0120
    71193:
    ST398NM01_0143
    ECT-R 2:
    ECTR2_85
    ED133:
    SAOV_0077
    ED98:
    SAAV_0097
    HO 5096 0412:
    SAEMRSA15_00960
    JH1:
    SaurJH1_0120
    JH9:
    SaurJH9_0115
    JKD6008:
    SAA6008_00107
    JKD6159:
    SAA6159_00112
    LGA251:
    SARLGA251_01040
    M013:
    M013TW_0119
    MRSA252:
    SAR0131
    MSHR1132:
    SAMSHR1132_01050
    MSSA476:
    SAS0103
    Mu3:
    SAHV_0128
    Mu50:
    SAV0129
    MW2:
    MW0103
    RF122:
    SAB0068 (cap5M)
    ST398:
    SAPIG0143
    T0131:
    SAT0131_00116
    TCH60:
    HMPREF0772_10369
    TW20:
    SATW20_01400
    USA300_TCH1516:
    USA300HOU_0141
    VC40:
    SAVC_00385

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKLQLKKWKCRENDIEAVHNNKGYAYQRKLDKLEEVRKSYYPIKRAIDLILSIVLLFLT
    N315            MKKLQLKKWKCRENDIEAVHNNKGYAYQRKLDALEEVRKGYYPIKRAIDLVLSIVLLFLT
    NCTC8325        MKKLQLKKWKCRENDIEAVHNNKGYAYQRKLDKLEEVRKSYYPIKRAIDLILSIVLLFLT
    Newman          MKKLQLKKWKCRENDIEAVHNNKGYAYQRKLDKLEEVRKSYYPIKRAIDLILSIVLLFLT
    USA300_FPR3757  MKKLQLKKWKCRENDIEAVHNNKGYAYQRKLDKLEEVRKSYYPIKRAIDLILSIVLLFLT
                    ******************************** ******.**********:*********

    COL             LPIMVIFAIAIVIDSPGNPIYSQVRVGKMGKLIKIYKLRSMCKNAEKNGAQWADKDDDRI
    N315            FPIMFIFAIAIVIDSPGNPIYSQVRVGKMGKLIKIYKLRSMCKNAEKNGAQWADKDDDRI
    NCTC8325        LPIMVIFAIAIVIDSPGNPIYSQVRVGKMGKLIKIYKLRSMCKNAEKNGAQWADKDDDRI
    Newman          LPIMVIFAIAIVIDSPGNPIYSQVRVGKMGKLIKIYKLRSMCKNAEKNGAQWADKDDDRI
    USA300_FPR3757  LPIMVIFAIAIVIDSPGNPIYSQVRVGKMGKLIKIYKLRSMCKNAEKNGAQWADKDDDRI
                    :***.*******************************************************

    COL             TNVGKFIRKTRIDELPQLINVVKGEMSFIGPRPERPEFVELFSSEVIGFEQRCLVTPGLT
    N315            TNVGKFIRKTRIDELPQLINVVKGEMSFIGPRPERPEFVELFSSEVIGFEQRCLVTPGLT
    NCTC8325        TNVGKFIRKTRIDELPQLINVVKGEMSFIGPRPERPEFVELFSSEVIGFEQRCLVTPGLT
    Newman          TNVGKFIRKTRIDELPQLINVVKGEMSFIGPRPERPEFVELFSSEVIGFEQRCLVTPGLT
    USA300_FPR3757  TNVGKFIRKTRIDELPQLINVVKGEMSFIGPRPERPEFVELFSSEVIGFEQRCLVTPGLT
                    ************************************************************

    COL             GLAQIQGGYDLTPQQKLKYDMKYIHKGSLMMELYISIRTLMVVITGEGSR
    N315            GLAQIQGGYDLTPQQKLKYDMKYIHKGSLMMELYISIRTLMVVITGEGSR
    NCTC8325        GLAQIQGGYDLTPQQKLKYDMKYIHKGSLMMELYISIRTLMVVITGEGSR
    Newman          GLAQIQGGYDLTPQQKLKYDMKYIHKGSLMMELYISIRTLMVVITGEGSR
    USA300_FPR3757  GLAQIQGGYDLTPQQKLKYDMKYIHKGSLMMELYISIRTLMVVITGEGSR
                    **************************************************