From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0157 [new locus tag: SA_RS00955 ]
  • pan locus tag?: SAUPAN000992000
  • symbol: capN
  • pan gene symbol?: capN
  • synonym:
  • product: capsular polysaccharide synthesis protein Cap5N

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0157 [new locus tag: SA_RS00955 ]
  • symbol: capN
  • product: capsular polysaccharide synthesis protein Cap5N
  • replicon: chromosome
  • strand: +
  • coordinates: 180552..181439
  • length: 888
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGAGAAAAAATATTTTAATTACAGGCGTACATGGATATATCGGTAATGCTTTAAAAGAT
    AAGCTTATTGAACAAGGACATCAAGTAGATCAAATTAATGTTAGGAATCAATTATGGAAG
    TCGACCTCGTTCAAAGATTATGATGTTTTAATTCATACAGCAGCTTTGGTTCACAACAAT
    TCACCTCAAGCAAGGCTATCTGATTATATGCAAGTGAATATGTTGCTTACGAAACAATTG
    GCACAAAAGGCTAAAGCTGAAGACGTTAAACAATTTATTTTTATGAGTACTATGGCAGTT
    TATGGAAAAGAAGGTCAGGTTGGTAAATCAGATCAAATTGATACACAAACACCAATGAAC
    CCTACGACCAACTATGGTATTTCCAAAAAGTTCGCTGAACAAGCATTACAAGAGTTGATT
    AGTGATTCGTTTAAAGTAGCAATTGTGAGACCACCAATGATTTATGGTGCACATTGCCCA
    GGAAATTTCCAACGGTTAATGCAATTGTCAAAGCGACTGCCAATCATTCCCAATATTAAC
    AATCAGCGCAGTGCATTATATATTAAACATCTGACAGCATTTATTGATCAATTAATATCA
    TTAGAAGTGACAGGCGTGTATCATCCTCAAGATAGTTTTTACTTTGATACATCGTCAGTA
    ATGTATGAAATACGTCGCCAATCACATCGTAAAACGGTATTGATCAACATGCCTTCAGTG
    TTAAATAAGTATTTTAATAAGTTGTCGGTCTTTAGAAAATTATTCGGCAATTTAACATAC
    AGCAATACGTTATATGAAAATAATAATGCACTTGAAGTTATTCCTGGAAAAATGTCACTT
    GTTATTGCGGACATCATGGATGAAACGACAACCAAAGATAAGGCATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    888

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0157 [new locus tag: SA_RS00955 ]
  • symbol: CapN
  • description: capsular polysaccharide synthesis protein Cap5N
  • length: 295
  • theoretical pI: 9.85627
  • theoretical MW: 33629.6
  • GRAVY: -0.303729

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesdTDP-4-dehydrorhamnose reductase (TIGR01214; EC 1.1.1.133; HMM-score: 67)
    MetabolismEnergy metabolismSugarsUDP-glucose 4-epimerase GalE (TIGR01179; EC 5.1.3.2; HMM-score: 59.8)
    thioester reductase domain (TIGR01746; HMM-score: 54.4)
    NAD dependent epimerase/dehydratase, LLPSF_EDH_00030 family (TIGR04180; HMM-score: 51.3)
    hopanoid-associated sugar epimerase (TIGR03466; HMM-score: 50.6)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesADP-glyceromanno-heptose 6-epimerase (TIGR02197; EC 5.1.3.20; HMM-score: 37.9)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesdTDP-glucose 4,6-dehydratase (TIGR01181; EC 4.2.1.46; HMM-score: 31.9)
    L-aminoadipate-semialdehyde dehydrogenase (TIGR03443; EC 1.2.1.31; HMM-score: 26.7)
    Hypothetical proteinsConservedTIGR01777 family protein (TIGR01777; HMM-score: 23.2)
    UDP-N-acetylglucosamine 4,6-dehydratase (inverting) (TIGR03589; EC 4.2.1.115; HMM-score: 15.1)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesGDP-mannose 4,6-dehydratase (TIGR01472; EC 4.2.1.47; HMM-score: 13.1)
    acetoacetyl-CoA reductase (TIGR01829; EC 1.1.1.36; HMM-score: 13.1)
    3-hydroxybutyrate dehydrogenase (TIGR01963; HMM-score: 11.9)
  • TheSEED:  
    Cell Wall and CapsuleCapsular and extracellular polysacchridesSerotype determining Capsular polysaccharide biosynthesis in Staphylococcus Capsular polysaccharide synthesis enzyme Cap8N 
  • PFAM:
    NADP_Rossmann (CL0063) Epimerase; NAD dependent epimerase/dehydratase family (PF01370; HMM-score: 86.3)
    NAD_binding_4; Male sterility protein (PF07993; HMM-score: 62.1)
    RmlD_sub_bind; RmlD substrate binding domain (PF04321; HMM-score: 56.8)
    3Beta_HSD; 3-beta hydroxysteroid dehydrogenase/isomerase family (PF01073; HMM-score: 51.8)
    GDP_Man_Dehyd; GDP-mannose 4,6 dehydratase (PF16363; HMM-score: 47.4)
    Polysacc_synt_2; Polysaccharide biosynthesis protein (PF02719; HMM-score: 33.6)
    NAD_binding_10; NAD(P)H-binding (PF13460; HMM-score: 33.4)
    no clan definedDnaB; DnaB-like helicase N terminal domain (PF00772; HMM-score: 18.7)
    NADP_Rossmann (CL0063) NmrA; NmrA-like family (PF05368; HMM-score: 12.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.132
    • Ymax_pos: 27
    • Cmax: 0.126
    • Cmax_pos: 67
    • Smax: 0.228
    • Smax_pos: 22
    • Smean: 0.149
    • D: 0.139
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 15925866 NCBI
  • RefSeq: NP_373399 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MRKNILITGVHGYIGNALKDKLIEQGHQVDQINVRNQLWKSTSFKDYDVLIHTAALVHNNSPQARLSDYMQVNMLLTKQLAQKAKAEDVKQFIFMSTMAVYGKEGQVGKSDQIDTQTPMNPTTNYGISKKFAEQALQELISDSFKVAIVRPPMIYGAHCPGNFQRLMQLSKRLPIIPNINNQRSALYIKHLTAFIDQLISLEVTGVYHPQDSFYFDTSSVMYEIRRQSHRKTVLINMPSVLNKYFNKLSVFRKLFGNLTYSNTLYENNNALEVIPGKMSLVIADIMDETTTKDKA

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: CodY
    CodY (TF) important in Amino acid metabolismRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]