From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000992000
  • symbol?: capN
  • description?: capsular polysaccharide synthesis enzyme Cap5N

      descriptions from strain specific annotations:

    • capsular polysaccharide synthesis enzyme Cap5N
    • NAD-dependent epimerase/dehydratase
    • capsular polysaccharide biosynthesis protein Cap5N
    • Capsular polysaccharide synthesis enzyme Cap8N
    • NAD dependent epimerase/dehydratase family protein
    • capsular polysaccharide synthesis protein Cap5N
    • polysaccharide biosynthesis family protein
    • cap5N protein/UDP-glucose 4-epimerase
    • capsular polysaccharide biosynthesis protein CapN
    • UDP-N-acetyl-D-quinovosamine 4-epimerase
    • capsular polysaccharide synthesis enzyme CapN
  • strand?: +
  • coordinates?: 1260968..1261855
  • synteny block?: BlockID0005250
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0149 (cap5N)
    N315:
    SA0157 (capN)
    NCTC8325:
    Newman:
    NWMN_0108 (capN)
    USA300_FPR3757:
    SAUSA300_0165 (cap5N)
    04-02981:
    SA2981_0163 (capN)
    08BA02176:
    C248_0151 (capN)
    11819-97:
    MS7_0156
    71193:
    ST398NM01_0176
    ECT-R 2:
    ECTR2_119
    ED133:
    SAOV_0109
    ED98:
    SAAV_0130 (cap5N)
    HO 5096 0412:
    SAEMRSA15_01280 (capN)
    JH1:
    SaurJH1_0153
    JH9:
    SaurJH9_0148
    JKD6008:
    SAA6008_00140 (cap5N)
    JKD6159:
    SAA6159_00146 (cap5N)
    LGA251:
    SARLGA251_01360 (capN)
    M013:
    M013TW_0152
    MRSA252:
    SAR0164 (capN)
    MSHR1132:
    SAMSHR1132_01360
    MSSA476:
    SAS0137
    Mu3:
    SAHV_0161 (capN)
    Mu50:
    SAV0162 (capN)
    MW2:
    MW0137 (cap8N)
    RF122:
    SAB0103 (capN)
    ST398:
    SAPIG0176
    T0131:
    SAT0131_00153 (sodA)
    TCH60:
    HMPREF0772_10336 (cap5N)
    TW20:
    SATW20_01730 (capN)
    USA300_TCH1516:
    USA300HOU_0176 (cap5N)
    VC40:
    SAVC_00580

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRKNILITGVHGYIGNALKDKLIEQGHQVDQINVRNQLWKSTSFKDYDVLIHTAALVHNN
    N315            MRKNILITGVHGYIGNALKDKLIEQGHQVDQINVRNQLWKSTSFKDYDVLIHTAALVHNN
    NCTC8325        MRKNILITGVHGYIGNALKDKLIEQGHQVDQINVRNQLWKSTSFKDYDVLIHTAALVHNN
    Newman          MRKNILITGVHGYIGNALKDKLIEQGHQVDQINVRNQLWKSTSFKDYDVLIHTAALVHNN
    USA300_FPR3757  MRKNILITGVHGYIGNALKDKLIEQGHQVDQINVRNQLWKSTSFKDYDVLIHTAALVHNN
                    ************************************************************

    COL             SPQARLSDYMQVNMLLTKQLAQKAKAEDVKQFIFMSTMAVYGKEGHVGKSDQVDTQTPMN
    N315            SPQARLSDYMQVNMLLTKQLAQKAKAEDVKQFIFMSTMAVYGKEGQVGKSDQIDTQTPMN
    NCTC8325        SPQARLSDYMQVNMLLTKQLAQKAKAEDVKQFIFMSTMAVYGKEGHVGKSDQVDTQTPMN
    Newman          SPQARLSDYMQVNMLLTKQLAQKAKAEDVKQFIFMSTMAVYGKEGHVGKSDQVDTQTPMN
    USA300_FPR3757  SPQARLSDYMQVNMLLTKQLAQKAKAEDVKQFIFMSTMAVYGKEGHVGKSDQVDTQTPMN
                    *********************************************:******:*******

    COL             PTTNYGISKKFAEQALQELISDSFKVAIVRPPMIYGAHCPGNFQRLMQLSKRLPIIPNIN
    N315            PTTNYGISKKFAEQALQELISDSFKVAIVRPPMIYGAHCPGNFQRLMQLSKRLPIIPNIN
    NCTC8325        PTTNYGISKKFAEQALQELISDSFKVAIVRPPMIYGAHCPGNFQRLMQLSKRLPIIPNIN
    Newman          PTTNYGISKKFAEQALQELISDSFKVAIVRPPMIYGAHCPGNFQRLMQLSKRLPIIPNIN
    USA300_FPR3757  PTTNYGISKKFAEQALQELISDSFKVAIVRPPMIYGAHCPGNFQRLMQLSKRLPIIPNIN
                    ************************************************************

    COL             NQRSALYIKHLTAFIDQLISLEVTGVYHPQDSFYFDTSSVMYEIRRQSHRKTVLINMPSM
    N315            NQRSALYIKHLTAFIDQLISLEVTGVYHPQDSFYFDTSSVMYEIRRQSHRKTVLINMPSV
    NCTC8325        NQRSALYIKHLTAFIDQLISLEVTGVYHPQDSFYFDTSSVMYEIRRQSHRKTVLINMPSM
    Newman          NQRSALYIKHLTAFIDQLISLEVTGVYHPQDSFYFDTSSVMYEIRRQSHRKTVLINMPSM
    USA300_FPR3757  NQRSALYIKHLTAFIDQLISLEVTGVYHPQDSFYFDTSSVMYEIRRQSHRKTVLINMPSM
                    ***********************************************************:

    COL             LNKYFNKLSVFRKLFGNLIYSNTLYENNNALEIIPGKMSLVIADIMDETTTKDKA
    N315            LNKYFNKLSVFRKLFGNLTYSNTLYENNNALEVIPGKMSLVIADIMDETTTKDKA
    NCTC8325        LNKYFNKLSVFRKLFGNLIYSNTLYENNNALEIIPGKMSLVIADIMDETTTKDKA
    Newman          LNKYFNKLSVFRKLFGNLIYSNTLYENNNALEIIPGKMSLVIADIMDETTTKDKA
    USA300_FPR3757  LNKYFNKLSVFRKLFGNLIYSNTLYENNNALEIIPGKMSLVIADIMDETTTKDKA
                    ****************** *************:**********************