From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0230 [new locus tag: SA_RS01345 ]
  • pan locus tag?: SAUPAN001103000
  • symbol: SA0230
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0230 [new locus tag: SA_RS01345 ]
  • symbol: SA0230
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 278901..279257
  • length: 357
  • essential: yes DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGACCGTAGATATTGGACGGATTTATGACAATAAAGATAATACCGACGCTATTCGTATC
    CTAGTCGATAGAGTCTGGCCGAGAGGTATTTCGAAAAGAACTGCTAACCTAGATTATTGG
    TTAAAAGACATTGCCCCTTCTACTGAGTTGCGACAATGGTTCCAACATGATCCTAAACTT
    TTTGGAGCTTTTAAAGAAAAATATGAAAAAGAATTACGTGATCAGGATGCGCAAAAAGAT
    GCTTTTGAAAAATTAAAGGATATTGTAAATCAGCATAATCATGTTCTATTGTTATATGCA
    GCAAAAGATACTAAACATAACCAAGCTGTAGTACTACAGCAGTTGCTCAATACTTAG
    60
    120
    180
    240
    300
    357

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0230 [new locus tag: SA_RS01345 ]
  • symbol: SA0230
  • description: hypothetical protein
  • length: 118
  • theoretical pI: 8.87228
  • theoretical MW: 13934.7
  • GRAVY: -0.734746

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    DUF488 family protein SAV0238 
  • PFAM:
    no clan definedDUF488; Protein of unknown function, DUF488 (PF04343; HMM-score: 110.5)
    HLH; Helix-loop-helix DNA-binding domain (PF00010; HMM-score: 12.9)
    Chemosens_recp (CL0176) 7tm_6; 7tm Odorant receptor (PF02949; HMM-score: 11.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.094
    • Ymax_pos: 68
    • Cmax: 0.107
    • Cmax_pos: 34
    • Smax: 0.099
    • Smax_pos: 70
    • Smean: 0.066
    • D: 0.083
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTVDIGRIYDNKDNTDAIRILVDRVWPRGISKRTANLDYWLKDIAPSTELRQWFQHDPKLFGAFKEKYEKELRDQDAQKDAFEKLKDIVNQHNHVLLLYAAKDTKHNQAVVLQQLLNT

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]